Recombinant Human SDC4 protein, GST-tagged
| Cat.No. : | SDC4-301204H |
| Product Overview : | Recombinant Human SDC4 (19-145 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | Glu19-Glu145 |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AA Sequence : | ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SDC4 syndecan 4 [ Homo sapiens ] |
| Official Symbol | SDC4 |
| Synonyms | SDC4; syndecan 4; syndecan 4 (amphiglycan, ryudocan); syndecan-4; amphiglycan; ryudocan; SYND4; syndecan proteoglycan 4; ryudocan amphiglycan; ryudocan core protein; MGC22217; |
| Gene ID | 6385 |
| mRNA Refseq | NM_002999 |
| Protein Refseq | NP_002990 |
| MIM | 600017 |
| UniProt ID | P31431 |
| ◆ Recombinant Proteins | ||
| Sdc4-6794M | Recombinant Mouse Sdc4 Protein (Glu24-Glu145), C-His tagged | +Inquiry |
| Sdc4-7017M | Recombinant Mouse Sdc4 protein(Met1-Val146), His-tagged | +Inquiry |
| SDC4-4107R | Recombinant Rhesus monkey SDC4 Protein, His-tagged | +Inquiry |
| SDC4-19H | Active Recombinant Human SDC4, His-tagged | +Inquiry |
| SDC4-4037H | Recombinant Human SDC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SDC4-1057MCL | Recombinant Mouse SDC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDC4 Products
Required fields are marked with *
My Review for All SDC4 Products
Required fields are marked with *



