Recombinant Human SDC4 protein, His-SUMO-tagged
Cat.No. : | SDC4-3947H |
Product Overview : | Recombinant Human SDC4 protein(P31431)(19-145aa), fused to N-terminal His-SUMO tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 19-145aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.9 kDa |
AA Sequence : | ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SDC4 syndecan 4 [ Homo sapiens ] |
Official Symbol | SDC4 |
Synonyms | SDC4; syndecan 4; syndecan 4 (amphiglycan, ryudocan); syndecan-4; amphiglycan; ryudocan; SYND4; syndecan proteoglycan 4; ryudocan amphiglycan; ryudocan core protein; MGC22217; |
Gene ID | 6385 |
mRNA Refseq | NM_002999 |
Protein Refseq | NP_002990 |
MIM | 600017 |
UniProt ID | P31431 |
◆ Recombinant Proteins | ||
SDC4-4945R | Recombinant Rat SDC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SDC4-19H | Active Recombinant Human SDC4, His-tagged | +Inquiry |
SDC4-505H | Recombinant Human SDC4, Fc-tagged | +Inquiry |
SDC4-4631H | Recombinant Syndecan 4 | +Inquiry |
SDC4-301204H | Recombinant Human SDC4 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDC4-1057MCL | Recombinant Mouse SDC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDC4 Products
Required fields are marked with *
My Review for All SDC4 Products
Required fields are marked with *