Recombinant Human SDC4 protein, His-SUMO-tagged

• Cat.No.: SDC4-3947H
• Product Overview: Recombinant Human SDC4 protein(P31431)(19-145aa), fused to N-terminal His-SUMO tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 19-145aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.9 kDa
• AA Sequence: ESIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTE
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SDC4 syndecan 4 [ Homo sapiens ]
• Official Symbol: SDC4
• Synonyms: SDC4; syndecan 4; syndecan 4 (amphiglycan, ryudocan); syndecan-4; amphiglycan; ryudocan; SYND4; syndecan proteoglycan 4; ryudocan amphiglycan; ryudocan core protein; MGC22217
• Gene ID: 6385
• mRNA Refseq: NM_002999
• Protein Refseq: NP_002990
• MIM: 600017
• UniProt ID: P31431