Recombinant Human SDCBP Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SDCBP-3893H |
Product Overview : | SDCBP MS Standard C13 and N15-labeled recombinant protein (NP_005616) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene was initially identified as a molecule linking syndecan-mediated signaling to the cytoskeleton. The syntenin protein contains tandemly repeated PDZ domains that bind the cytoplasmic, C-terminal domains of a variety of transmembrane proteins. This protein may also affect cytoskeletal-membrane organization, cell adhesion, protein trafficking, and the activation of transcription factors. The protein is primarily localized to membrane-associated adherens junctions and focal adhesions but is also found at the endoplasmic reticulum and nucleus. Alternative splicing results in multiple transcript variants encoding different isoforms. Related pseudogenes have been identified on multiple chromosomes. |
Molecular Mass : | 32.4 kDa |
AA Sequence : | MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SDCBP syndecan binding protein [ Homo sapiens (human) ] |
Official Symbol | SDCBP |
Synonyms | SDCBP; syndecan binding protein (syntenin); syntenin-1; SYCL; scaffold protein Pbp1; syndecan-binding protein 1; melanoma differentiation associated protein-9; melanoma differentiation-associated protein 9; pro-TGF-alpha cytoplasmic domain-interacting protein 18; ST1; MDA-9; TACIP18; |
Gene ID | 6386 |
mRNA Refseq | NM_005625 |
Protein Refseq | NP_005616 |
MIM | 602217 |
UniProt ID | O00560 |
◆ Recombinant Proteins | ||
SDCBP-698H | Recombinant Human SDCBP Protein, His-tagged | +Inquiry |
SDCBP-5280H | Recombinant Human SDCBP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SDCBP-4108R | Recombinant Rhesus monkey SDCBP Protein, His-tagged | +Inquiry |
Sdcbp-5728M | Recombinant Mouse Sdcbp Protein, Myc/DDK-tagged | +Inquiry |
SDCBP-11967Z | Recombinant Zebrafish SDCBP | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDCBP-2015HCL | Recombinant Human SDCBP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SDCBP Products
Required fields are marked with *
My Review for All SDCBP Products
Required fields are marked with *
0
Inquiry Basket