Recombinant Human SDF2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SDF2-1398H |
Product Overview : | SDF2 MS Standard C13 and N15-labeled recombinant protein (NP_008854) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15. |
Molecular Mass : | 23 kDa |
AA Sequence : | MAVVPLLLLGGLWSAVGASSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAELTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SDF2 stromal cell-derived factor 2 [ Homo sapiens (human) ] |
Official Symbol | SDF2 |
Synonyms | SDF2; stromal cell-derived factor 2; SDF-2; FLJ17932; |
Gene ID | 6388 |
mRNA Refseq | NM_006923 |
Protein Refseq | NP_008854 |
MIM | 602934 |
UniProt ID | Q99470 |
◆ Recombinant Proteins | ||
SDF2-6254H | Recombinant Human SDF2 Protein (Ser19-Leu211), His tagged | +Inquiry |
Sdf2-7018M | Recombinant Mouse Sdf2 protein(Met1-Leu211), His-tagged | +Inquiry |
SDF2-10394Z | Recombinant Zebrafish SDF2 | +Inquiry |
SDF2-2214H | Recombinant Human SDF2 protein, His-tagged | +Inquiry |
SDF2-2105M | Recombinant Mouse SDF2 Protein (19-211 aa), His-Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDF2-545MCL | Recombinant Mouse SDF2 cell lysate | +Inquiry |
SDF2-729HCL | Recombinant Human SDF2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDF2 Products
Required fields are marked with *
My Review for All SDF2 Products
Required fields are marked with *