Recombinant Human SDF2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SDF2-1398H
Product Overview : SDF2 MS Standard C13 and N15-labeled recombinant protein (NP_008854) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is believed to be a secretory protein. It has regions of similarity to hydrophilic segments of yeast mannosyltransferases. Its expression is ubiquitous and the gene appears to be relatively conserved among mammals. Alternate splicing results in both coding and non-coding variants. A pseudogene of this gene is located on chromosome 15.
Molecular Mass : 23 kDa
AA Sequence : MAVVPLLLLGGLWSAVGASSLGVVTCGSVVKLLNTRHNVRLHSHDVRYGSGSGQQSVTGVTSVDDSNSYWRIRGKSATVCERGTPIKCGQPIRLTHVNTGRNLHSHHFTSPLSGNQEVSAFGEEGEGDYLDDWTVLCNGPYWVRDGEVRFKHSSTEVLLSVTGEQYGRPISGQKEVHGMAQPSQNNYWKAMEGIFMKPSELLKAEAHHAELTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SDF2 stromal cell-derived factor 2 [ Homo sapiens (human) ]
Official Symbol SDF2
Synonyms SDF2; stromal cell-derived factor 2; SDF-2; FLJ17932;
Gene ID 6388
mRNA Refseq NM_006923
Protein Refseq NP_008854
MIM 602934
UniProt ID Q99470

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDF2 Products

Required fields are marked with *

My Review for All SDF2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon