Recombinant Human SDHA protein, His-tagged

Cat.No. : SDHA-3476H
Product Overview : Recombinant Human SDHA protein(P31040)(44-293aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 44-293aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 31.1 kDa
AA Sequence : SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SDHA succinate dehydrogenase complex, subunit A, flavoprotein (Fp) [ Homo sapiens ]
Official Symbol SDHA
Synonyms SDHA; succinate dehydrogenase complex, subunit A, flavoprotein (Fp); SDH2; succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial; FP; SDHF; flavoprotein subunit of complex II; succinate dehydrogenase complex flavoprotein subunit; PGL5; SDH1; CMD1GG;
Gene ID 6389
mRNA Refseq NM_004168
Protein Refseq NP_004159
MIM 600857
UniProt ID P31040

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDHA Products

Required fields are marked with *

My Review for All SDHA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon