Recombinant Human SDHA protein, His-tagged
Cat.No. : | SDHA-3476H |
Product Overview : | Recombinant Human SDHA protein(P31040)(44-293aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 44-293aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 31.1 kDa |
AA Sequence : | SAKVSDSISAQYPVVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIEDGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SDHA succinate dehydrogenase complex, subunit A, flavoprotein (Fp) [ Homo sapiens ] |
Official Symbol | SDHA |
Synonyms | SDHA; succinate dehydrogenase complex, subunit A, flavoprotein (Fp); SDH2; succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial; FP; SDHF; flavoprotein subunit of complex II; succinate dehydrogenase complex flavoprotein subunit; PGL5; SDH1; CMD1GG; |
Gene ID | 6389 |
mRNA Refseq | NM_004168 |
Protein Refseq | NP_004159 |
MIM | 600857 |
UniProt ID | P31040 |
◆ Recombinant Proteins | ||
SDHA-3476H | Recombinant Human SDHA protein, His-tagged | +Inquiry |
SDHA-5290R | Recombinant Rat SDHA Protein | +Inquiry |
SDHA-2676H | Recombinant Human SDHA Protein, His-tagged | +Inquiry |
Sdha-1714M | Recombinant Mouse Sdha protein, His & T7-tagged | +Inquiry |
SDHA-7966M | Recombinant Mouse SDHA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDHA-2011HCL | Recombinant Human SDHA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SDHA Products
Required fields are marked with *
My Review for All SDHA Products
Required fields are marked with *
0
Inquiry Basket