Recombinant Human SDHB, His-tagged
| Cat.No. : | SDHB-31392TH | 
| Product Overview : | Recombinant full length protein, corresponding to amino acids 1-280 of Human SDHB with N terminal His tag, MWt 35kDa. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 1-280 a.a. | 
| Description : | Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. | 
| Conjugation : | HIS | 
| Form : | Lyophilised:Reconstitute with 96 μl aqua dest. | 
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 | 
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIK KFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIK IKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRR IDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIE PYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCST SCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLA KLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMM ATYKEKKASV | 
| Sequence Similarities : | Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.Contains 1 2Fe-2S ferredoxin-type domain.Contains 1 4Fe-4S ferredoxin-type domain. | 
| Full Length : | Full L. | 
| Gene Name | SDHB succinate dehydrogenase complex, subunit B, iron sulfur (Ip) [ Homo sapiens ] | 
| Official Symbol | SDHB | 
| Synonyms | SDHB; succinate dehydrogenase complex, subunit B, iron sulfur (Ip); SDH, SDH1; succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; | 
| Gene ID | 6390 | 
| mRNA Refseq | NM_003000 | 
| Protein Refseq | NP_002991 | 
| MIM | 185470 | 
| Uniprot ID | P21912 | 
| Chromosome Location | 1p36.1-p35 | 
| Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate => | 
| Function | 2 iron, 2 sulfur cluster binding; 3 iron, 4 sulfur cluster binding; 4 iron, 4 sulfur cluster binding; electron carrier activity; metal ion binding; | 
| ◆ Recombinant Proteins | ||
| SDHB-31392TH | Recombinant Human SDHB, His-tagged | +Inquiry | 
| SDHB-5703Z | Recombinant Zebrafish SDHB | +Inquiry | 
| SDHB-4951R | Recombinant Rat SDHB Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Sdhb-1710M | Recombinant Mouse Sdhb protein, His & T7-tagged | +Inquiry | 
| SDHB-140H | Recombinant Human SDHB Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SDHB-2009HCL | Recombinant Human SDHB 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDHB Products
Required fields are marked with *
My Review for All SDHB Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            