Recombinant Human SDHB, His-tagged
Cat.No. : | SDHB-31392TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-280 of Human SDHB with N terminal His tag, MWt 35kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-280 a.a. |
Description : | Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 96 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIK KFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIK IKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRR IDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIE PYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCST SCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLA KLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMM ATYKEKKASV |
Sequence Similarities : | Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.Contains 1 2Fe-2S ferredoxin-type domain.Contains 1 4Fe-4S ferredoxin-type domain. |
Full Length : | Full L. |
Gene Name | SDHB succinate dehydrogenase complex, subunit B, iron sulfur (Ip) [ Homo sapiens ] |
Official Symbol | SDHB |
Synonyms | SDHB; succinate dehydrogenase complex, subunit B, iron sulfur (Ip); SDH, SDH1; succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial; |
Gene ID | 6390 |
mRNA Refseq | NM_003000 |
Protein Refseq | NP_002991 |
MIM | 185470 |
Uniprot ID | P21912 |
Chromosome Location | 1p36.1-p35 |
Pathway | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate => |
Function | 2 iron, 2 sulfur cluster binding; 3 iron, 4 sulfur cluster binding; 4 iron, 4 sulfur cluster binding; electron carrier activity; metal ion binding; |
◆ Recombinant Proteins | ||
SDHB-5321C | Recombinant Chicken SDHB | +Inquiry |
Sdhb-1710M | Recombinant Mouse Sdhb protein, His & T7-tagged | +Inquiry |
SDHB-5292R | Recombinant Rat SDHB Protein | +Inquiry |
SDHB-4112R | Recombinant Rhesus monkey SDHB Protein, His-tagged | +Inquiry |
SDHB-369H | Recombinant Human SDHB | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDHB-2009HCL | Recombinant Human SDHB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDHB Products
Required fields are marked with *
My Review for All SDHB Products
Required fields are marked with *