Recombinant Human SDHB, His-tagged

Cat.No. : SDHB-31392TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-280 of Human SDHB with N terminal His tag, MWt 35kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-280 a.a.
Description : Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ. The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane. The iron-sulfur subunit is highly conserved and contains three cysteine-rich clusters which may comprise the iron-sulfur centers of the enzyme. Sporadic and familial mutations in this gene result in paragangliomas and pheochromocytoma, and support a link between mitochondrial dysfunction and tumorigenesis.
Conjugation : HIS
Form : Lyophilised:Reconstitute with 96 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIK KFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIK IKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRR IDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIE PYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCST SCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLA KLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMM ATYKEKKASV
Sequence Similarities : Belongs to the succinate dehydrogenase/fumarate reductase iron-sulfur protein family.Contains 1 2Fe-2S ferredoxin-type domain.Contains 1 4Fe-4S ferredoxin-type domain.
Full Length : Full L.
Gene Name SDHB succinate dehydrogenase complex, subunit B, iron sulfur (Ip) [ Homo sapiens ]
Official Symbol SDHB
Synonyms SDHB; succinate dehydrogenase complex, subunit B, iron sulfur (Ip); SDH, SDH1; succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial;
Gene ID 6390
mRNA Refseq NM_003000
Protein Refseq NP_002991
MIM 185470
Uniprot ID P21912
Chromosome Location 1p36.1-p35
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate =>
Function 2 iron, 2 sulfur cluster binding; 3 iron, 4 sulfur cluster binding; 4 iron, 4 sulfur cluster binding; electron carrier activity; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDHB Products

Required fields are marked with *

My Review for All SDHB Products

Required fields are marked with *

0

Inquiry Basket

cartIcon