Recombinant Human SEC13 protein, GST-tagged
| Cat.No. : | SEC13-3774H |
| Product Overview : | Recombinant Human SEC13 protein(1-325 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 14, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-325 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | MGKMVSVINTVDTSHEDMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVNKGQGSVSASVTEGQQNEQ |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SEC13 SEC13 homolog (S. cerevisiae) [ Homo sapiens ] |
| Official Symbol | SEC13 |
| Synonyms | SEC13; SEC13 homolog (S. cerevisiae); D3S1231E, SEC13 (S. cerevisiae) like 1 , SEC13 like 1 (S. cerevisiae) , SEC13L1; protein SEC13 homolog; npp 20; SEC13R; SEC13-like 1 isoform; SEC13-like protein 1; SEC13-related protein; npp-20; SEC13L1; D3S1231E; |
| Gene ID | 6396 |
| mRNA Refseq | NM_001136232 |
| Protein Refseq | NP_001129704 |
| MIM | 600152 |
| UniProt ID | P55735 |
| ◆ Recombinant Proteins | ||
| SEC13-14819M | Recombinant Mouse SEC13 Protein | +Inquiry |
| SEC13-5298R | Recombinant Rat SEC13 Protein | +Inquiry |
| SEC13-3774H | Recombinant Human SEC13 protein, GST-tagged | +Inquiry |
| SEC13-2560H | Recombinant Human SEC13, His-tagged | +Inquiry |
| SEC13-4120R | Recombinant Rhesus monkey SEC13 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SEC13-2000HCL | Recombinant Human SEC13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEC13 Products
Required fields are marked with *
My Review for All SEC13 Products
Required fields are marked with *
