Recombinant Human SEC14L1 protein, GST-tagged
Cat.No. : | SEC14L1-301150H |
Product Overview : | Recombinant Human SEC14L1 (149-233 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met149-Gly233 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MKQYTSNIKKGKEIIEYYLRQLEEEGITFVPRWSPPSITPSSETSSSSSKKQAASMAVVIPEAALKEGLSGDALSSPSAPEPVVG |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SEC14L1 SEC14-like 1 (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SEC14L1 |
Synonyms | SEC14L1; SEC14-like 1 (S. cerevisiae); SEC14 (S. cerevisiae) like 1 , SEC14L; SEC14-like protein 1; PRELID4A; SEC14L; DKFZp686C06176; |
Gene ID | 6397 |
mRNA Refseq | NM_001039573 |
Protein Refseq | NP_001034662 |
MIM | 601504 |
UniProt ID | Q92503 |
◆ Recombinant Proteins | ||
SEC14L1-1886H | Recombinant Human SEC14L1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Sec14l1-5740M | Recombinant Mouse Sec14l1 Protein, Myc/DDK-tagged | +Inquiry |
SEC14L1-11320Z | Recombinant Zebrafish SEC14L1 | +Inquiry |
SEC14L1-4121R | Recombinant Rhesus monkey SEC14L1 Protein, His-tagged | +Inquiry |
SEC14L1-301150H | Recombinant Human SEC14L1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC14L1-1999HCL | Recombinant Human SEC14L1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEC14L1 Products
Required fields are marked with *
My Review for All SEC14L1 Products
Required fields are marked with *