Recombinant Human SEC14L2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SEC14L2-4273H |
Product Overview : | SEC14L2 MS Standard C13 and N15-labeled recombinant protein (NP_036561) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. |
Molecular Mass : | 46 kDa |
AA Sequence : | MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SEC14L2 SEC14 like lipid binding 2 [ Homo sapiens (human) ] |
Official Symbol | SEC14L2 |
Synonyms | SEC14L2; SEC14-like 2 (S. cerevisiae); C22orf6, SEC14 (S. cerevisiae) like 2; SEC14-like protein 2; KIAA1186; KIAA1658; SPF; supernatant protein factor; TAP; squalene transfer protein; tocopherol-associated protein; alpha-tocopherol-associated protein; TAP1; C22orf6; MGC65053; |
Gene ID | 23541 |
mRNA Refseq | NM_012429 |
Protein Refseq | NP_036561 |
MIM | 607558 |
UniProt ID | O76054 |
◆ Recombinant Proteins | ||
SEC14L2-89H | Recombinant Human SEC14L2 protein, His-tagged | +Inquiry |
SEC14L2-4273H | Recombinant Human SEC14L2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Sec14l2-5741M | Recombinant Mouse Sec14l2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC14L2-1998HCL | Recombinant Human SEC14L2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEC14L2 Products
Required fields are marked with *
My Review for All SEC14L2 Products
Required fields are marked with *