Recombinant Human SEC14L2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SEC14L2-4273H
Product Overview : SEC14L2 MS Standard C13 and N15-labeled recombinant protein (NP_036561) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
Molecular Mass : 46 kDa
AA Sequence : MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SEC14L2 SEC14 like lipid binding 2 [ Homo sapiens (human) ]
Official Symbol SEC14L2
Synonyms SEC14L2; SEC14-like 2 (S. cerevisiae); C22orf6, SEC14 (S. cerevisiae) like 2; SEC14-like protein 2; KIAA1186; KIAA1658; SPF; supernatant protein factor; TAP; squalene transfer protein; tocopherol-associated protein; alpha-tocopherol-associated protein; TAP1; C22orf6; MGC65053;
Gene ID 23541
mRNA Refseq NM_012429
Protein Refseq NP_036561
MIM 607558
UniProt ID O76054

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SEC14L2 Products

Required fields are marked with *

My Review for All SEC14L2 Products

Required fields are marked with *

0
cart-icon