Recombinant Human SEC14L2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SEC14L2-4273H
• Product Overview: SEC14L2 MS Standard C13 and N15-labeled recombinant protein (NP_036561) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
• Molecular Mass: 46 kDa
• AA Sequence: MSGRVGDLSPRQKEALAKFRENVQDVLPALPNPDDYFLLRWLRARSFDLQKSEAMLRKHVEFRKQKDIDNIISWQPPEVIQQYLSGGMCGYDLDGCPVWYDIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETITIIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFPVAYNLIKPFLSEDTRKKIMVLGANWKEVLLKHISPDQVPVEYGGTMTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQISRGSSHQVEYEILFPGCVLRWQFMSDGADVGFGIFLKTKMGERQRAGEMTEVLPNQRYNSHLVPEDGTLTCSDPGIYVLRFDNTYSFIHAKKVNFTVEVLLPDKASEEKMKQLGAGTPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SEC14L2 SEC14 like lipid binding 2 [ Homo sapiens (human) ]
• Official Symbol: SEC14L2
• Synonyms: SEC14L2; SEC14-like 2 (S. cerevisiae); C22orf6, SEC14 (S. cerevisiae) like 2; SEC14-like protein 2; KIAA1186; KIAA1658; SPF; supernatant protein factor; TAP; squalene transfer protein; tocopherol-associated protein; alpha-tocopherol-associated protein; TAP1; C22orf6; MGC65053
• Gene ID: 23541
• mRNA Refseq: NM_012429
• Protein Refseq: NP_036561
• MIM: 607558
• UniProt ID: O76054