Recombinant Human SEC16A Protein (1943-2154 aa), His-tagged

Cat.No. : SEC16A-799H
Product Overview : Recombinant Human SEC16A Protein (1943-2154 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1943-2154 aa
Description : Defines endoplasmic reticulum exit sites (ERES) and is required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus. SAR1A-GTP-dependent assbly of SEC16A on the ER mbrane forms an organized scaffold defining an ERES. Required for normal transitional endoplasmic reticulum (tER) organization.
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 26.1 kDa
AA Sequence : AYLPDDKNKSIVWDEKKNQWVNLNEPEEEKKAPPPPPTSMPKTVQAAPPALPGPPGAPVNMYSRRAAGTRARYVDVLNPSGTQRSEPALAPADFVAPLAPLPIPSNLFVPTPDAEEPQLPDGTGREGPAAARGLANPEPAPEPKVLSSAASLPGSELPSSRPEGSQGGELSRCSSMSSLSREVSQHFNQAPGDLPAAGGPPSGAMPFYNPAQ
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name SEC16A SEC16 homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol SEC16A
Synonyms SEC16A; KIAA0310; p250; SEC16L; FLJ26737; RP11-413M3.10;
Gene ID 9919
mRNA Refseq NM_014866
Protein Refseq NP_055681
MIM 612854
UniProt ID O15027

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SEC16A Products

Required fields are marked with *

My Review for All SEC16A Products

Required fields are marked with *

0
cart-icon
0
compare icon