Recombinant Human SEC23A protein, GST-tagged
Cat.No. : | SEC23A-7855H |
Product Overview : | Recombinant Human SEC23A protein(660-765 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 660-765 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | HGETIAQWRKSGYQDMPEYENFRHLLQAPVDDAQEILHSRFPMPRYIDTEHGGSQARFLLSKVNPSQTHNNMYAWGQESGAPILTDDVSLQVFMDHLKKLAVSSAA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SEC23A Sec23 homolog A (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SEC23A |
Synonyms | SEC23A; Sec23 homolog A (S. cerevisiae); Sec23 (S. cerevisiae) homolog A; protein transport protein Sec23A; SEC23-related protein A; CLSD; MGC26267; |
Gene ID | 10484 |
mRNA Refseq | NM_006364 |
Protein Refseq | NP_006355 |
MIM | 610511 |
UniProt ID | Q15436 |
◆ Recombinant Proteins | ||
SEC23A-802H | Recombinant Human SEC23A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Sec23a-5744M | Recombinant Mouse Sec23a Protein, Myc/DDK-tagged | +Inquiry |
SEC23A-7986M | Recombinant Mouse SEC23A Protein, His (Fc)-Avi-tagged | +Inquiry |
SEC23A-7855H | Recombinant Human SEC23A protein, GST-tagged | +Inquiry |
SEC23A-2563H | Recombinant Human SEC23A, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC23A-1994HCL | Recombinant Human SEC23A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEC23A Products
Required fields are marked with *
My Review for All SEC23A Products
Required fields are marked with *