Recombinant Human SELE Protein, His-tagged
Cat.No. : | SELE-128H |
Product Overview : | Recombinant Human SELE Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-556 a.a. |
Description : | Selectins, also designated CD62 antigens, comprise a family of carbohydratebinding proteins involved in mediating cellular interactions with leukocytes. L-Selectin (also designated LECAM-1 or CD62L) is expressed on the majority of B and naive T cells and on most monocytes, neutrophils and eosinophils. L-Selectin interacts with specific carbohydrates expressed by activated endothelial cells. P-Selectin (also designated GMP-140 or CD62P), expressed on activated platelets and endothelial cells, and E-Selectin (also designated ELMA-1 or CD62E), expressed on endothelial cells, exhibit overlapping ligand specificities. E-Selectin is expressed by cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. |
Molecular Mass : | ~62 kDa |
AA Sequence : | MWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | SELE selectin E [ Homo sapiens (human) ] |
Official Symbol | SELE |
Synonyms | SELE; selectin E; ELAM, ELAM1, endothelial adhesion molecule 1; E-selectin; CD62E; ESEL; ELAM-1; endothelial adhesion molecule 1; CD62 antigen-like family member E; endothelial leukocyte adhesion molecule 1; leukocyte endothelial cell adhesion molecule 2; leukocyte-endothelial cell adhesion molecule 2; ELAM; ELAM1; LECAM2; |
Gene ID | 6401 |
mRNA Refseq | NM_000450 |
Protein Refseq | NP_000441 |
MIM | 131210 |
UniProt ID | P16581 |
◆ Recombinant Proteins | ||
SELE-612R | Recombinant Rabbit SELE protein, His & T7-tagged | +Inquiry |
Sele-4093R | Active Recombinant Rat Sele protein(Met1-Pro494), His-tagged | +Inquiry |
SELE-597H | Recombinant Human SELE Protein, MYC/DDK-tagged | +Inquiry |
Sele-1720M | Recombinant Mouse Selectin, Endothelial Cell, Fc-His | +Inquiry |
Sele-1972M | Active Recombinant Mouse Sele protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SELE-2992HCL | Recombinant Human SELE cell lysate | +Inquiry |
SELE-845MCL | Recombinant Mouse SELE cell lysate | +Inquiry |
SELE-960RCL | Recombinant Rat SELE cell lysate | +Inquiry |
SELE-1099CCL | Recombinant Cynomolgus SELE cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SELE Products
Required fields are marked with *
My Review for All SELE Products
Required fields are marked with *
0
Inquiry Basket