Species : |
Human |
Source : |
E.coli |
Tag : |
His |
Protein Length : |
22-556 a.a. |
Description : |
Selectins, also designated CD62 antigens, comprise a family of carbohydratebinding proteins involved in mediating cellular interactions with leukocytes. L-Selectin (also designated LECAM-1 or CD62L) is expressed on the majority of B and naive T cells and on most monocytes, neutrophils and eosinophils. L-Selectin interacts with specific carbohydrates expressed by activated endothelial cells. P-Selectin (also designated GMP-140 or CD62P), expressed on activated platelets and endothelial cells, and E-Selectin (also designated ELMA-1 or CD62E), expressed on endothelial cells, exhibit overlapping ligand specificities. E-Selectin is expressed by cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. |
Molecular Mass : |
~62 kDa |
AA Sequence : |
MWSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIP |
Purity : |
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : |
For research use only, not for use in diagnostic procedure. |
Storage : |
Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : |
PBS, 4M Urea, pH7.4 |