Recombinant Human SEMA3B protein, GST-tagged SEMA3B-251H

Recombinant Human SEMA3B protein, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human SEMA3B protein, GST-tagged

Recombinant Human SEMA3B protein, GST-tagged

SEMA3B Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : SEMA3B-251H
Product Overview : Recombinant Human SEMA3B(651 a.a. - 748 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description : The semaphorin/collapsin family of molecules plays a critical role in the guidance of growth cones during neuronal development. The secreted protein encoded by this gene family member is important in axonal guidance and has been shown to act as a tumor suppressor by inducing apoptosis.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.52 kDa
AA Sequence : FTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPALQSLPLESRR KGRNRRTHAPEPRAERGPRSATH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : SEMA3B sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B [ Homo sapiens ]
Official Symbol : SEMA3B
Synonyms : SEMA3B; sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B; SEMAA; semaphorin-3B; LUCA 1; SemA; sema5; semaV; sema V; sema A(V); semaphorin A; semaphorin V; semaphorin-V; SEMA5; LUCA-1; FLJ34863;
Gene ID : 7869
mRNA Refseq : NM_004636
Protein Refseq : NP_004627
MIM : 601281
UniProt ID : Q13214
Chromosome Location : 3p21.3
Pathway : Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem;
Function : receptor activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy