Recombinant Human SEMA3B protein, GST-tagged

Cat.No. : SEMA3B-251H
Product Overview : Recombinant Human SEMA3B(651 a.a. - 748 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 651-748 a.a.
Description : The semaphorin/collapsin family of molecules plays a critical role in the guidance of growth cones during neuronal development. The secreted protein encoded by this gene family member is important in axonal guidance and has been shown to act as a tumor suppressor by inducing apoptosis.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.52 kDa
AA Sequence : FTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPALQSLPLESRR KGRNRRTHAPEPRAERGPRSATH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name SEMA3B sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B [ Homo sapiens ]
Official Symbol SEMA3B
Synonyms SEMA3B; sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B; SEMAA; semaphorin-3B; LUCA 1; SemA; sema5; semaV; sema V; sema A(V); semaphorin A; semaphorin V; semaphorin-V; SEMA5; LUCA-1; FLJ34863;
Gene ID 7869
mRNA Refseq NM_004636
Protein Refseq NP_004627
MIM 601281
UniProt ID Q13214
Chromosome Location 3p21.3
Pathway Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem;
Function receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SEMA3B Products

Required fields are marked with *

My Review for All SEMA3B Products

Required fields are marked with *

0
cart-icon