Recombinant Human SEMA3B protein, GST-tagged
Cat.No. : | SEMA3B-251H |
Product Overview : | Recombinant Human SEMA3B(651 a.a. - 748 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 651-748 a.a. |
Description : | The semaphorin/collapsin family of molecules plays a critical role in the guidance of growth cones during neuronal development. The secreted protein encoded by this gene family member is important in axonal guidance and has been shown to act as a tumor suppressor by inducing apoptosis. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.52 kDa |
AA Sequence : | FTQPLRRLSLHVLSATQAERLARAEEAAPAAPPGPKLWYRDFLQLVEPGGGGSANSLRMCRPQPALQSLPLESRR KGRNRRTHAPEPRAERGPRSATH |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | SEMA3B sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B [ Homo sapiens ] |
Official Symbol | SEMA3B |
Synonyms | SEMA3B; sema domain, immunoglobulin domain (Ig), short basic domain, secreted, (semaphorin) 3B; SEMAA; semaphorin-3B; LUCA 1; SemA; sema5; semaV; sema V; sema A(V); semaphorin A; semaphorin V; semaphorin-V; SEMA5; LUCA-1; FLJ34863; |
Gene ID | 7869 |
mRNA Refseq | NM_004636 |
Protein Refseq | NP_004627 |
MIM | 601281 |
UniProt ID | Q13214 |
Chromosome Location | 3p21.3 |
Pathway | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; |
Function | receptor activity; |
◆ Recombinant Proteins | ||
SEMA3B-5900H | Recombinant Human SEMA3B protein, His&Myc-tagged | +Inquiry |
SEMA3B-251H | Recombinant Human SEMA3B protein, GST-tagged | +Inquiry |
SEMA3B-2679H | Recombinant Human SEMA3B Protein, His-tagged | +Inquiry |
SEMA3B-1213H | Recombinant Human SEMA3B protein, His-tagged | +Inquiry |
Sema3b-105M | Recombinant Mouse Sema3b Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEMA3B-1981HCL | Recombinant Human SEMA3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEMA3B Products
Required fields are marked with *
My Review for All SEMA3B Products
Required fields are marked with *