Recombinant Human SEMA4G, His-tagged
Cat.No. : | SEMA4G-185H |
Product Overview : | Recombinant Human Semaphorin 4G/SEMA4G is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val18-Leu680) of Human SEMA4G fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 18-680 a.a. |
Description : | Semaphorin-4G is the least characterized of the seven known Class 4 transmembrane semaphorin glycoproteins. Class 4 semaphorins play multiple roles in cell attraction or repulsion, such as development of nerve pathways in the brain, promoting or inhibiting proliferation, in some cases organizing immune cell interactions. Semaphorin-4G can be expressed early in development in the central and peripheral nervous systems and in sensory ograns, such as cochlea, olfactory epithelium, vomeronasal organ and retina. In adults, Semaphorin-4G can be found in liver,kidney and brain. The human Semaphorin-4G precursor consists of a 17 amino acids signal sequence, a 658 amino acids extracellular domain, a 21 amino acids transmembrane domain, a 142 amino acids cytoplasmic domain with one Ser/Thr phosphorylation site. |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
AA Sequence : | VPGPSLRRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSAN DIGDGAHKEIHWEASPEMQSKCHQKGKNNQTECFNHVRFLQRLNSTHLYACGTHAFQPLCAAIDA EAFTLPTSFEEGKEKCPYDPARGFTGLIIDGGLYTATRYEFRSIPDIRRSRHPHSLRTEETPMHW LNDAEFVFSVLVRESKASAVGDDDKVYYFFTERATEEGSGSFTQSRSSHRVARVARVCKGDLGGK KILQKKWTSFLKARLICHIPLYETLRGVCSLDAETSSRTHFYAAFTLSTQWKTLEASAICRYDLA EIQAVFAGPYMEYQDGSRRWGRYEGGVPEPRPGSCITDSLRSQGYNSSQDLPSLVLDFVKLHPLM ARPVVPTRGRPLLLKRNIRYTHLTGTPVTTPAGPTYDLLFLGTADGWIHKAVVLGSGMHIIEETQ VFRESQSVENLVISLLQHSLYVGAPSGVIQLPLSSCSRYRSCYDCILARDPYCGWDPGTHACAAA TTIANRSQGSRTALIQDIERGNRGCESSRDTGPPPPLKTRSVLRGDDVLLPCDQPSNLARALWLL NGSMGLSDGQGGYRVGVDGLLVTDAQPEHSGNYGCYAEENGLRTLLASYSLTVRPATPAPAPKAP ATPGAQLAPDVRLVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | SEMA4G sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G [ Homo sapiens ] |
Official Symbol | SEMA4G |
Synonyms | SEMA4G; sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G; |
Gene ID | 10504 |
◆ Recombinant Proteins | ||
SEMA4G-185H | Recombinant Human SEMA4G, His-tagged | +Inquiry |
SEMA4G-14871M | Recombinant Mouse SEMA4G Protein | +Inquiry |
SEMA4G-190H | Active Recombinant Human SEMA4G Protein, Fc-tagged | +Inquiry |
SEMA4G-8008M | Recombinant Mouse SEMA4G Protein, His (Fc)-Avi-tagged | +Inquiry |
SEMA4G-6095H | Recombinant Human SEMA4G Protein (Val18-Leu680), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEMA4G-1581HCL | Recombinant Human SEMA4G cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEMA4G Products
Required fields are marked with *
My Review for All SEMA4G Products
Required fields are marked with *
0
Inquiry Basket