| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
His |
| Protein Length : |
18-680 a.a. |
| Description : |
Semaphorin-4G is the least characterized of the seven known Class 4 transmembrane semaphorin glycoproteins. Class 4 semaphorins play multiple roles in cell attraction or repulsion, such as development of nerve pathways in the brain, promoting or inhibiting proliferation, in some cases organizing immune cell interactions. Semaphorin-4G can be expressed early in development in the central and peripheral nervous systems and in sensory ograns, such as cochlea, olfactory epithelium, vomeronasal organ and retina. In adults, Semaphorin-4G can be found in liver,kidney and brain. The human Semaphorin-4G precursor consists of a 17 amino acids signal sequence, a 658 amino acids extracellular domain, a 21 amino acids transmembrane domain, a 142 amino acids cytoplasmic domain with one Ser/Thr phosphorylation site. |
| Form : |
Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4 |
| AA Sequence : |
VPGPSLRRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSAN DIGDGAHKEIHWEASPEMQSKCHQKGKNNQTECFNHVRFLQRLNSTHLYACGTHAFQPLCAAIDA EAFTLPTSFEEGKEKCPYDPARGFTGLIIDGGLYTATRYEFRSIPDIRRSRHPHSLRTEETPMHW LNDAEFVFSVLVRESKASAVGDDDKVYYFFTERATEEGSGSFTQSRSSHRVARVARVCKGDLGGK KILQKKWTSFLKARLICHIPLYETLRGVCSLDAETSSRTHFYAAFTLSTQWKTLEASAICRYDLA EIQAVFAGPYMEYQDGSRRWGRYEGGVPEPRPGSCITDSLRSQGYNSSQDLPSLVLDFVKLHPLM ARPVVPTRGRPLLLKRNIRYTHLTGTPVTTPAGPTYDLLFLGTADGWIHKAVVLGSGMHIIEETQ VFRESQSVENLVISLLQHSLYVGAPSGVIQLPLSSCSRYRSCYDCILARDPYCGWDPGTHACAAA TTIANRSQGSRTALIQDIERGNRGCESSRDTGPPPPLKTRSVLRGDDVLLPCDQPSNLARALWLL NGSMGLSDGQGGYRVGVDGLLVTDAQPEHSGNYGCYAEENGLRTLLASYSLTVRPATPAPAPKAP ATPGAQLAPDVRLVDHHHHHH |
| Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Storage : |
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
| Reconstitution : |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
