Recombinant Human SEMA4G, His-tagged

Cat.No. : SEMA4G-185H
Product Overview : Recombinant Human Semaphorin 4G/SEMA4G is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Val18-Leu680) of Human SEMA4G fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 18-680 a.a.
Description : Semaphorin-4G is the least characterized of the seven known Class 4 transmembrane semaphorin glycoproteins. Class 4 semaphorins play multiple roles in cell attraction or repulsion, such as development of nerve pathways in the brain, promoting or inhibiting proliferation, in some cases organizing immune cell interactions. Semaphorin-4G can be expressed early in development in the central and peripheral nervous systems and in sensory ograns, such as cochlea, olfactory epithelium, vomeronasal organ and retina. In adults, Semaphorin-4G can be found in liver,kidney and brain. The human Semaphorin-4G precursor consists of a 17 amino acids signal sequence, a 658 amino acids extracellular domain, a 21 amino acids transmembrane domain, a 142 amino acids cytoplasmic domain with one Ser/Thr phosphorylation site.
Form : Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.4
AA Sequence : VPGPSLRRPSRELDATPRMTIPYEELSGTRHFKGQAQNYSTLLLEEASARLLVGARGALFSLSAN DIGDGAHKEIHWEASPEMQSKCHQKGKNNQTECFNHVRFLQRLNSTHLYACGTHAFQPLCAAIDA EAFTLPTSFEEGKEKCPYDPARGFTGLIIDGGLYTATRYEFRSIPDIRRSRHPHSLRTEETPMHW LNDAEFVFSVLVRESKASAVGDDDKVYYFFTERATEEGSGSFTQSRSSHRVARVARVCKGDLGGK KILQKKWTSFLKARLICHIPLYETLRGVCSLDAETSSRTHFYAAFTLSTQWKTLEASAICRYDLA EIQAVFAGPYMEYQDGSRRWGRYEGGVPEPRPGSCITDSLRSQGYNSSQDLPSLVLDFVKLHPLM ARPVVPTRGRPLLLKRNIRYTHLTGTPVTTPAGPTYDLLFLGTADGWIHKAVVLGSGMHIIEETQ VFRESQSVENLVISLLQHSLYVGAPSGVIQLPLSSCSRYRSCYDCILARDPYCGWDPGTHACAAA TTIANRSQGSRTALIQDIERGNRGCESSRDTGPPPPLKTRSVLRGDDVLLPCDQPSNLARALWLL NGSMGLSDGQGGYRVGVDGLLVTDAQPEHSGNYGCYAEENGLRTLLASYSLTVRPATPAPAPKAP ATPGAQLAPDVRLVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution : Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name SEMA4G sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G [ Homo sapiens ]
Official Symbol SEMA4G
Synonyms SEMA4G; sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 4G;
Gene ID 10504

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SEMA4G Products

Required fields are marked with *

My Review for All SEMA4G Products

Required fields are marked with *

0

Inquiry Basket

cartIcon