Recombinant Human SENP2 protein
Cat.No. : | SENP2-32H |
Product Overview : | Recombinant Human SENP2(Asp363-Leu589) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 363-589 a.a. |
Description : | SENP2 is an enzyme that belongs to the peptidase C48 family. SENP2 is a protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. SUMO1 is a small ubiquitin-like protein that can be covalently conjugated to other proteins. It has been implicated as a down-regulator of CTNNB1 levels and may therefore be a modulator of the Wnt pathway. |
Form : | Supplied as a 0.2 μm filtered solution of 50mM HEPES,5% Glycerol, pH 7.4. |
AA Sequence : | DDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYMNLLVERN KKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWSLVVIDLRKKCLK YLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIPQQLNGSDCGMFTCKYAD YISRDKPITFTQHQMPLFRKKMVWEILHQQLL |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Store at < -20 centigrade, stable for 6 months after receipt. Please minimize freeze-thaw cycles. |
Gene Name | SENP2 SUMO1/sentrin/SMT3 specific peptidase 2 [ Homo sapiens ] |
Official Symbol | SENP2 |
Synonyms | SENP2; SUMO1/sentrin/SMT3 specific peptidase 2; SUMO1/sentrin/SMT3 specific protease 2; sentrin-specific protease 2; AXAM2; DKFZp762A2316; KIAA1331; SMT3IP2; SMT3-specific isopeptidase 2; sentrin/SUMO-specific protease SENP2; |
Gene ID | 59343 |
mRNA Refseq | NM_021627 |
Protein Refseq | NP_067640 |
MIM | 608261 |
UniProt ID | Q9HC62 |
Chromosome Location | 3q28 |
Pathway | Nuclear pore complex, organism-specific biosystem; RNA transport, organism-specific biosystem; RNA transport, conserved biosystem; Wnt Signaling Pathway NetPath, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem; |
Function | SUMO-specific protease activity; cysteine-type peptidase activity; peptidase activity; protein binding; protein domain specific binding; |
◆ Recombinant Proteins | ||
SENP2-29695TH | Recombinant Human SENP2, His-tagged | +Inquiry |
SENP2-152H | Active Recombinant Human SENP2 protein, His-tagged | +Inquiry |
Senp2-688M | Recombinant Mouse Senp2, His-tagged | +Inquiry |
SENP2-5317R | Recombinant Rat SENP2 Protein | +Inquiry |
SENP2-4976R | Recombinant Rat SENP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SENP2-583HCL | Recombinant Human SENP2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SENP2 Products
Required fields are marked with *
My Review for All SENP2 Products
Required fields are marked with *
0
Inquiry Basket