Recombinant Human SENP8 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SENP8-6271H
Product Overview : SENP8 MS Standard C13 and N15-labeled recombinant protein (NP_660205) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregulated 8. Alternate splicing results in multiple transcript variants.
Molecular Mass : 24.1 kDa
AA Sequence : MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SENP8 SUMO/sentrin specific peptidase family member 8 [ Homo sapiens (human) ]
Official Symbol SENP8
Synonyms SENP8; SUMO/sentrin specific peptidase family member 8; protease, cysteine, 2 (NEDD8 specific), PRSC2, SUMO/sentrin specific protease family member 8; sentrin-specific protease 8; DEN1; deneddylase 1; HsT17512; NEDD8 specific protease 1; NEDP1; sentrin/SUMO specific protease SENP8; deneddylase-1; protease, cysteine 2; NEDD8-specific protease 1; NEDD8 specific-protease cysteine 2; SUMO sentrin specific protease family member 8; PRSC2;
Gene ID 123228
mRNA Refseq NM_145204
Protein Refseq NP_660205
MIM 608659
UniProt ID Q96LD8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SENP8 Products

Required fields are marked with *

My Review for All SENP8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon