Recombinant Human SENP8 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SENP8-6271H
• Product Overview: SENP8 MS Standard C13 and N15-labeled recombinant protein (NP_660205) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a cysteine protease that is a member of the sentrin-specific protease family. The encoded protein is involved in processing and deconjugation of the ubiquitin-like protein termed, neural precursor cell expressed developmentally downregulated 8. Alternate splicing results in multiple transcript variants.
• Molecular Mass: 24.1 kDa
• AA Sequence: MDPVVLSYMDSLLRQSDVSLLDPPSWLNDHIIGFAFEYFANSQFHDCSDHVSFISPEVTQFIKCTSNPAEIAMFLEPLDLPNKRVVFLAINDNSNQAAGGTHWSLLVYLQDKNSFFHYDSHSRSNSVHAKQVAEKLEAFLGRKGDKLAFVEEKAPAQQNSYDCGMYVICNTEALCQNFFRQQTESLLQLLTPAYITKKRGEWKDLIATLAKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SENP8 SUMO/sentrin specific peptidase family member 8 [ Homo sapiens (human) ]
• Official Symbol: SENP8
• Synonyms: SENP8; SUMO/sentrin specific peptidase family member 8; protease, cysteine, 2 (NEDD8 specific), PRSC2, SUMO/sentrin specific protease family member 8; sentrin-specific protease 8; DEN1; deneddylase 1; HsT17512; NEDD8 specific protease 1; NEDP1; sentrin/SUMO specific protease SENP8; deneddylase-1; protease, cysteine 2; NEDD8-specific protease 1; NEDD8 specific-protease cysteine 2; SUMO sentrin specific protease family member 8; PRSC2
• Gene ID: 123228
• mRNA Refseq: NM_145204
• Protein Refseq: NP_660205
• MIM: 608659
• UniProt ID: Q96LD8