Recombinant Human SERP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SERP2-5737H
Product Overview : SERP2 MS Standard C13 and N15-labeled recombinant protein (NP_001010897) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SERP2 (Stress Associated Endoplasmic Reticulum Protein Family Member 2) is a Protein Coding gene. Diseases associated with SERP2 include Mixed Malaria. An important paralog of this gene is SERP1.
Molecular Mass : 7.4 kDa
AA Sequence : MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMGMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SERP2 stress associated endoplasmic reticulum protein family member 2 [ Homo sapiens (human) ]
Official Symbol SERP2
Synonyms SERP2; stress associated endoplasmic reticulum protein family member 2; C13orf21; bA269C23.1; stress-associated endoplasmic reticulum protein 2; ribosome-associated membrane protein RAMP4-2
Gene ID 387923
mRNA Refseq NM_001010897
Protein Refseq NP_001010897
UniProt ID Q8N6R1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERP2 Products

Required fields are marked with *

My Review for All SERP2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon