Recombinant Human SERP2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SERP2-5737H
• Product Overview: SERP2 MS Standard C13 and N15-labeled recombinant protein (NP_001010897) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SERP2 (Stress Associated Endoplasmic Reticulum Protein Family Member 2) is a Protein Coding gene. Diseases associated with SERP2 include Mixed Malaria. An important paralog of this gene is SERP1.
• Molecular Mass: 7.4 kDa
• AA Sequence: MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMGMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SERP2 stress associated endoplasmic reticulum protein family member 2 [ Homo sapiens (human) ]
• Official Symbol: SERP2
• Synonyms: SERP2; stress associated endoplasmic reticulum protein family member 2; C13orf21; bA269C23.1; stress-associated endoplasmic reticulum protein 2; ribosome-associated membrane protein RAMP4-2
• Gene ID: 387923
• mRNA Refseq: NM_001010897
• Protein Refseq: NP_001010897
• UniProt ID: Q8N6R1