Recombinant Human SERP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SERP2-5737H |
Product Overview : | SERP2 MS Standard C13 and N15-labeled recombinant protein (NP_001010897) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SERP2 (Stress Associated Endoplasmic Reticulum Protein Family Member 2) is a Protein Coding gene. Diseases associated with SERP2 include Mixed Malaria. An important paralog of this gene is SERP1. |
Molecular Mass : | 7.4 kDa |
AA Sequence : | MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMGMTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SERP2 stress associated endoplasmic reticulum protein family member 2 [ Homo sapiens (human) ] |
Official Symbol | SERP2 |
Synonyms | SERP2; stress associated endoplasmic reticulum protein family member 2; C13orf21; bA269C23.1; stress-associated endoplasmic reticulum protein 2; ribosome-associated membrane protein RAMP4-2 |
Gene ID | 387923 |
mRNA Refseq | NM_001010897 |
Protein Refseq | NP_001010897 |
UniProt ID | Q8N6R1 |
◆ Recombinant Proteins | ||
Serp2-5782M | Recombinant Mouse Serp2 Protein, Myc/DDK-tagged | +Inquiry |
SERP2-5737H | Recombinant Human SERP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERP2-8505Z | Recombinant Zebrafish SERP2 | +Inquiry |
SERP2-8037M | Recombinant Mouse SERP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERP2-14912M | Recombinant Mouse SERP2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERP2-1941HCL | Recombinant Human SERP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERP2 Products
Required fields are marked with *
My Review for All SERP2 Products
Required fields are marked with *
0
Inquiry Basket