Recombinant Human SERPINA1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SERPINA1-6352H |
Product Overview : | SERPINA1 MS Standard C13 and N15-labeled recombinant protein (NP_001121172) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is secreted and is a serine protease inhibitor whose targets include elastase, plasmin, thrombin, trypsin, chymotrypsin, and plasminogen activator. Defects in this gene can cause emphysema or liver disease. Several transcript variants encoding the same protein have been found for this gene. |
Molecular Mass : | 46.7 kDa |
AA Sequence : | Tags(s)XCRLLSRGASSCWQACAAWSLSPWLRIPREMLPRRQIHPTMIRITQPSTRSPPTWLSSPSAYTASWHTSPTAPISSSPQ*ASLQPLQCSPWGPRLTLTMKSWRA*ISTSRRFRRLRSMKASRNSSVPSTSQTASSS*PPAMACSSARA*S*WISFWRMLKSCTTQKPSLSTSGTPKRPRNRSTITWRRVLKGKLWIWSRSLTETQFLLW*ITSSLKANGRDPLKSRTPRKRTSTWTR*PP*RCL**SV*ACLTSSTVRSCPAGCC**NTWAMPPPSSSCLMRGNYSTWKMNSPTISSPSSWKMKTEGLPAYIYPNCPLLEPMI*RASWVNWASLRSSAMGLTSPGSQRRHP*SSPRPCIRLC*PSTRKGLKLLGPCF*RPYPCLSPPRSSSTNPLSS**LTKIPSLPSSWEKW*IPPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SERPINA1 serpin family A member 1 [ Homo sapiens (human) ] |
Official Symbol | SERPINA1 |
Synonyms | SERPINA1; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1; PI, serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 1; alpha-1-antitrypsin; A1A; A1AT; AAT; alpha 1 antitrypsin; alpha1AT; PI1; protease inhibitor 1 (anti elastase); serpin A1; alpha-1-antiproteinase; alpha-1-antitrypsin null; alpha-1 protease inhibitor; protease inhibitor 1 (anti-elastase), alpha-1-antitrypsin; serine (or cysteine) proteinase inhibitor, clade A, member 1; PI; PRO2275; MGC9222; MGC23330; |
Gene ID | 5265 |
mRNA Refseq | NM_001127700 |
Protein Refseq | NP_001121172 |
MIM | 107400 |
UniProt ID | P01009 |
◆ Recombinant Proteins | ||
SERPINA1-3590H | Recombinant Human SERPINA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SERPINA1-5334R | Recombinant Rat SERPINA1 Protein | +Inquiry |
SERPINA1-011O | Recombinant Human SERPINA1 | +Inquiry |
SERPINA1-003H | Recombinant Human SERPINA1 Protein | +Inquiry |
SERPINA1-570H | Recombinant Human SERPINA1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
SERPINA1-27286TH | Native Human SERPINA1 | +Inquiry |
SERPINA1-P035H | Native Human alpha-1 proteinase inhibitor therapeutic protein (Aralast, Aralast NP, Glassia, Prolastin, Prolastin-C, Zemaira) | +Inquiry |
SERPINA1-5358H | Native Human Serpin Peptidase Inhibitor, Clade A (alpha-1 antiproteinase, antitrypsin), Member 1 | +Inquiry |
SERPINA1-8009H | Native Human Serum Alpha 1 AntiTrypsin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINA1-2856HCL | Recombinant Human SERPINA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINA1 Products
Required fields are marked with *
My Review for All SERPINA1 Products
Required fields are marked with *
0
Inquiry Basket