Recombinant Human SERPINA10, His-tagged
| Cat.No. : | SERPINA10-186H |
| Product Overview : | Recombinant Human Serpin A10 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Leu22-Leu444) of Human SERPINA10 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 22-444 a.a. |
| Description : | Serpin A10 is a secreted protein that belongs to the serpin family. It is predominantly expressed in the liver and secreted in the plasma. Its phosphorylation sites are present in the extracelllular medium. It inhibits factors Xa and XIa of the coagulation cascade in the presence of protein Z, calcium, and phospholipid. Mutations in SERPINA10 are associated with venous thrombosis. |
| AA Sequence : | LAPSPQSPETPAPQNQTSRVVQAPKEEEEDEQEASEEKASEEEKAWLMASRQQLAKETSNFGFSL LRKISMRHDGNMVFSPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRET LSRNLELGLTQGSFAFIHKDFDVKETFFNLSKRYFDTECVPMNFRNASQAKRLMNHYINKETRGK IPKLFDEINPETKLILVDYILFKGKWLTPFDPVFTEVDTFHLDKYKTIKVPMMYGAGKFASTFDK NFRCHVLKLPYQGNATMLVVLMEKMGDHLALEDYLTTDLVETWLRNMKTRNMEVFFPKFKLDQKY EMHELLRQMGIRRIFSPFADLSELSATGRNLQVSRVLQRTVIEVDERGTEAVAGILSEITAYSMP PVIKVDRPFHFMIYEETSGMLLFLGRVVNPTLLLDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| Gene Name | SERPINA10 serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10 [ Homo sapiens ] |
| Official Symbol | SERPINA10 |
| Synonyms | SERPINA10; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; serine (or cysteine) proteinase inhibitor, clade A (alpha 1 antiproteinase, antitrypsin), member 10; protein Z-dependent protease inhibitor; PZI; ZPI; serpin A10; PZ-dependent protease inhibitor; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 10; |
| Gene ID | 51156 |
| mRNA Refseq | NM_001100607 |
| Protein Refseq | NP_001094077 |
| MIM | 605271 |
| UniProt ID | Q9UK55 |
| Chromosome Location | 14q32.1 |
| Function | peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
| ◆ Recombinant Proteins | ||
| Serpina10-2105R | Recombinant Rat Serpina10 protein, His & S-tagged | +Inquiry |
| SERPINA10-5894H | Recombinant Human SERPINA10 Protein (Leu22-Leu444), C-His tagged | +Inquiry |
| SERPINA10-5335R | Recombinant Rat SERPINA10 Protein | +Inquiry |
| Serpina10-4023M | Recombinant Mouse Serpina10 protein, His-tagged | +Inquiry |
| SERPINA10-865H | Recombinant Human SERPINA10 Protein, MYC/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERPINA10-2068MCL | Recombinant Mouse SERPINA10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINA10 Products
Required fields are marked with *
My Review for All SERPINA10 Products
Required fields are marked with *
