Recombinant Human SERPINB1 protein(211-340 aa), C-His-tagged
Cat.No. : | SERPINB1-2718H |
Product Overview : | Recombinant Human SERPINB1 protein(P30740)(211-340 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 211-340 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGI |
Gene Name | SERPINB1 serpin peptidase inhibitor, clade B (ovalbumin), member 1 [ Homo sapiens ] |
Official Symbol | SERPINB1 |
Synonyms | SERPINB1; serpin peptidase inhibitor, clade B (ovalbumin), member 1; ELANH2, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1; leukocyte elastase inhibitor; anti elastase; EI; PI2; PI-2; serpin B1; anti-elastase; peptidase inhibitor 2; monocyte/neutrophil elastase inhibitor; protease inhibitor 2 (anti-elastase), monocyte/neutrophil derived; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1; LEI; MNEI; M/NEI; ELANH2; |
Gene ID | 1992 |
mRNA Refseq | NM_030666 |
Protein Refseq | NP_109591 |
MIM | 130135 |
UniProt ID | P30740 |
◆ Recombinant Proteins | ||
SERPINB1-3480H | Recombinant Human SERPINB1 protein, His-SUMO-tagged | +Inquiry |
SERPINB1-0055H | Recombinant Human SERPINB1 Protein (Full Length), Tag Free | +Inquiry |
SerpinB1-3981H | Recombinant Human SerpinB1 protein, His-tagged | +Inquiry |
SERPINB1-763Z | Recombinant Zebrafish SERPINB1 | +Inquiry |
SERPINB1-3966R | Recombinant Rhesus Macaque SERPINB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB1-578HCL | Recombinant Human SERPINB1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINB1 Products
Required fields are marked with *
My Review for All SERPINB1 Products
Required fields are marked with *