Recombinant Human SERPINB1 protein(211-340 aa), C-His-tagged

Cat.No. : SERPINB1-2718H
Product Overview : Recombinant Human SERPINB1 protein(P30740)(211-340 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 211-340 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DLKCRVLELPYQGEELSMVILLPDDIEDESTGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIVHKSFVEVNEEGTEAAAATAGI
Gene Name SERPINB1 serpin peptidase inhibitor, clade B (ovalbumin), member 1 [ Homo sapiens ]
Official Symbol SERPINB1
Synonyms SERPINB1; serpin peptidase inhibitor, clade B (ovalbumin), member 1; ELANH2, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1; leukocyte elastase inhibitor; anti elastase; EI; PI2; PI-2; serpin B1; anti-elastase; peptidase inhibitor 2; monocyte/neutrophil elastase inhibitor; protease inhibitor 2 (anti-elastase), monocyte/neutrophil derived; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 1; LEI; MNEI; M/NEI; ELANH2;
Gene ID 1992
mRNA Refseq NM_030666
Protein Refseq NP_109591
MIM 130135
UniProt ID P30740

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINB1 Products

Required fields are marked with *

My Review for All SERPINB1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon