Recombinant Human SERPINB12 protein, His-tagged
Cat.No. : | SERPINB12-3155H |
Product Overview : | Recombinant Human SERPINB12 protein(1-130 aa), fused to His tag, was expressed in E. coli. |
Availability | August 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-130 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MDSLVTANTKFCFDLFQEIGKDDRHKNIFFSPLSLSAALGMVRLGARSDSAHQIDEVLHFNEFSQNESKEPDPCLKSNKQKVLADSSLEGQKKTTEPLDQQAGSLNNESGLVSCYFGQLLSKLDRIKTDY |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SERPINB12 serpin peptidase inhibitor, clade B (ovalbumin), member 12 [ Homo sapiens ] |
Official Symbol | SERPINB12 |
Synonyms | SERPINB12; serpin peptidase inhibitor, clade B (ovalbumin), member 12; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 12; serpin B12; YUKOPIN; MGC119247; MGC119248; |
Gene ID | 89777 |
mRNA Refseq | NM_080474 |
Protein Refseq | NP_536722 |
UniProt ID | Q96P63 |
◆ Recombinant Proteins | ||
SerpinB12-3081M | Recombinant Mouse SerpinB12 protein(Met1-Pro423), His-tagged | +Inquiry |
SERPINB12-2443H | Recombinant Human SERPINB12 protein, His-tagged | +Inquiry |
SERPINB12-3155H | Recombinant Human SERPINB12 protein, His-tagged | +Inquiry |
SERPINB12-6677H | Recombinant Human SERPINB12 Protein (Met1-Pro425), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB12-646MCL | Recombinant Mouse SERPINB12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINB12 Products
Required fields are marked with *
My Review for All SERPINB12 Products
Required fields are marked with *