Recombinant Human SERPINB12 protein, His-tagged
| Cat.No. : | SERPINB12-3155H |
| Product Overview : | Recombinant Human SERPINB12 protein(1-130 aa), fused to His tag, was expressed in E. coli. |
| Availability | January 09, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-130 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MDSLVTANTKFCFDLFQEIGKDDRHKNIFFSPLSLSAALGMVRLGARSDSAHQIDEVLHFNEFSQNESKEPDPCLKSNKQKVLADSSLEGQKKTTEPLDQQAGSLNNESGLVSCYFGQLLSKLDRIKTDY |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SERPINB12 serpin peptidase inhibitor, clade B (ovalbumin), member 12 [ Homo sapiens ] |
| Official Symbol | SERPINB12 |
| Synonyms | SERPINB12; serpin peptidase inhibitor, clade B (ovalbumin), member 12; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 12; serpin B12; YUKOPIN; MGC119247; MGC119248; |
| Gene ID | 89777 |
| mRNA Refseq | NM_080474 |
| Protein Refseq | NP_536722 |
| UniProt ID | Q96P63 |
| ◆ Recombinant Proteins | ||
| SERPINB12-3155H | Recombinant Human SERPINB12 protein, His-tagged | +Inquiry |
| SerpinB12-3081M | Recombinant Mouse SerpinB12 protein(Met1-Pro423), His-tagged | +Inquiry |
| SERPINB12-6677H | Recombinant Human SERPINB12 Protein (Met1-Pro425), C-His tagged | +Inquiry |
| SERPINB12-2443H | Recombinant Human SERPINB12 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERPINB12-646MCL | Recombinant Mouse SERPINB12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINB12 Products
Required fields are marked with *
My Review for All SERPINB12 Products
Required fields are marked with *
