Recombinant Human SERPINB3

• Cat.No.: SERPINB3-31163TH
• Product Overview: Recombinant fragment of Human SerpinB3 protein with an N terminal proprietary tag; predicted mwt: 38.28 kDa inclusive of tag.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 115 amino acids
• Description: Serpin B3 is a protein that in humans is encoded by the SERPINB3 gene.
• Molecular Weight: 38.280kDa inclusive of tags
• Tissue specificity: Squamous cells. Expressed in some hepatocellular carcinoma (at protein level).
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLS GMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSS PTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
• Sequence Similarities: Belongs to the serpin family. Ov-serpin subfamily.

Gene Information

• Gene Name: SERPINB3 serpin peptidase inhibitor, clade B (ovalbumin), member 3 [ Homo sapiens ]
• Official Symbol: SERPINB3
• Synonyms: SERPINB3; serpin peptidase inhibitor, clade B (ovalbumin), member 3; SCC, SCCA1, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; serpin B3; HsT1196; T4 A
• Gene ID: 6317
• mRNA Refseq: NM_006919
• Protein Refseq: NP_008850
• MIM: 600517
• Uniprot ID: P29508
• Chromosome Location: 18q21.3
• Pathway: Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem
• Function: peptidase inhibitor activity; serine-type endopeptidase inhibitor activity