Recombinant Human SERPINB3
Cat.No. : | SERPINB3-31163TH |
Product Overview : | Recombinant fragment of Human SerpinB3 protein with an N terminal proprietary tag; predicted mwt: 38.28 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 115 amino acids |
Description : | Serpin B3 is a protein that in humans is encoded by the SERPINB3 gene. |
Molecular Weight : | 38.280kDa inclusive of tags |
Tissue specificity : | Squamous cells. Expressed in some hepatocellular carcinoma (at protein level). |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLS GMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSS PTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP |
Sequence Similarities : | Belongs to the serpin family. Ov-serpin subfamily. |
Gene Name | SERPINB3 serpin peptidase inhibitor, clade B (ovalbumin), member 3 [ Homo sapiens ] |
Official Symbol | SERPINB3 |
Synonyms | SERPINB3; serpin peptidase inhibitor, clade B (ovalbumin), member 3; SCC, SCCA1, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; serpin B3; HsT1196; T4 A; |
Gene ID | 6317 |
mRNA Refseq | NM_006919 |
Protein Refseq | NP_008850 |
MIM | 600517 |
Uniprot ID | P29508 |
Chromosome Location | 18q21.3 |
Pathway | Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; |
Function | peptidase inhibitor activity; serine-type endopeptidase inhibitor activity; |
◆ Recombinant Proteins | ||
SERPINB3-72H | Recombinant Human SERPINB3, His-tagged | +Inquiry |
SERPINB3-2685H | Recombinant Human SERPINB3 Protein, His-tagged | +Inquiry |
SERPINB3-2593H | Recombinant Human SERPINB3 protein, GST-tagged | +Inquiry |
SERPINB3-2684H | Recombinant Human SERPINB3 Protein, His-tagged | +Inquiry |
SERPINB3-999H | Recombinant Human SERPINB3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINB3-460HCL | Recombinant Human SERPINB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SERPINB3 Products
Required fields are marked with *
My Review for All SERPINB3 Products
Required fields are marked with *
0
Inquiry Basket