Recombinant Human SERPINB3

Cat.No. : SERPINB3-31163TH
Product Overview : Recombinant fragment of Human SerpinB3 protein with an N terminal proprietary tag; predicted mwt: 38.28 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 115 amino acids
Description : Serpin B3 is a protein that in humans is encoded by the SERPINB3 gene.
Molecular Weight : 38.280kDa inclusive of tags
Tissue specificity : Squamous cells. Expressed in some hepatocellular carcinoma (at protein level).
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : RETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLS GMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSS PTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Sequence Similarities : Belongs to the serpin family. Ov-serpin subfamily.
Gene Name SERPINB3 serpin peptidase inhibitor, clade B (ovalbumin), member 3 [ Homo sapiens ]
Official Symbol SERPINB3
Synonyms SERPINB3; serpin peptidase inhibitor, clade B (ovalbumin), member 3; SCC, SCCA1, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; serpin B3; HsT1196; T4 A;
Gene ID 6317
mRNA Refseq NM_006919
Protein Refseq NP_008850
MIM 600517
Uniprot ID P29508
Chromosome Location 18q21.3
Pathway Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem;
Function peptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINB3 Products

Required fields are marked with *

My Review for All SERPINB3 Products

Required fields are marked with *

0
cart-icon