Recombinant Human SERPINB3 protein, GST-tagged
| Cat.No. : | SERPINB3-2593H |
| Product Overview : | Recombinant Human SERPINB3 protein(1-390 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | December 18, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | GST |
| Protein Length : | 1-390 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP |
| Purity : | 85%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | SERPINB3 serpin peptidase inhibitor, clade B (ovalbumin), member 3 [ Homo sapiens ] |
| Official Symbol | SERPINB3 |
| Synonyms | SERPINB3; serpin peptidase inhibitor, clade B (ovalbumin), member 3; SCC, SCCA1, serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; serpin B3; HsT1196; T4 A; protein T4-A; squamous cell carcinoma antigen 1; serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3; SCC; T4-A; SCCA1; SCCA-1; SCCA-PD; |
| mRNA Refseq | NM_006919 |
| Protein Refseq | NP_008850 |
| MIM | 600517 |
| UniProt ID | P29508 |
| Gene ID | 6317 |
| ◆ Recombinant Proteins | ||
| SERPINB3-5477H | Recombinant Human SERPINB3 protein | +Inquiry |
| SERPINB3-1335H | Acitve Recombinant Human SERPINB3 protein(Asn2-Pro390), His-tagged | +Inquiry |
| SERPINB3-2593H | Recombinant Human SERPINB3 protein, GST-tagged | +Inquiry |
| SERPINB3-6237H | Recombinant Human SERPINB3 Protein (Met1-Pro390), N-His tagged | +Inquiry |
| SERPINB3-2684H | Recombinant Human SERPINB3 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERPINB3-460HCL | Recombinant Human SERPINB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINB3 Products
Required fields are marked with *
My Review for All SERPINB3 Products
Required fields are marked with *
