Recombinant Human SERPING1 protein(31-100 aa), C-His-tagged

Cat.No. : SERPING1-2557H
Product Overview : Recombinant Human SERPING1 protein(P05155)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 31-100 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : SQDPESLQDRGEGKVATTVISKMLFVEPILEVSSLPTTNSTTNSATKITANTTDEPTTQPTTEPTTQPTI
Gene Name SERPING1 serpin peptidase inhibitor, clade G (C1 inhibitor), member 1 [ Homo sapiens ]
Official Symbol SERPING1
Synonyms SERPING1; serpin peptidase inhibitor, clade G (C1 inhibitor), member 1; C1NH, serine (or cysteine) proteinase inhibitor, clade G (C1 inhibitor), member 1, (angioedema, hereditary); plasma protease C1 inhibitor; angioedema; hereditary; C1 INH; C1IN; HAE1; HAE2; serpin G1; C1-inhibiting factor; C1 esterase inhibitor; complement component 1 inhibitor; serine/cysteine proteinase inhibitor clade G member 1; C1NH; C1INH;
Gene ID 710
mRNA Refseq NM_000062
Protein Refseq NP_000053
MIM 606860
UniProt ID P05155

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPING1 Products

Required fields are marked with *

My Review for All SERPING1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon