Recombinant Human SERPING1 protein(31-100 aa), C-His-tagged
Cat.No. : | SERPING1-2557H |
Product Overview : | Recombinant Human SERPING1 protein(P05155)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-100 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | SQDPESLQDRGEGKVATTVISKMLFVEPILEVSSLPTTNSTTNSATKITANTTDEPTTQPTTEPTTQPTI |
Gene Name | SERPING1 serpin peptidase inhibitor, clade G (C1 inhibitor), member 1 [ Homo sapiens ] |
Official Symbol | SERPING1 |
Synonyms | SERPING1; serpin peptidase inhibitor, clade G (C1 inhibitor), member 1; C1NH, serine (or cysteine) proteinase inhibitor, clade G (C1 inhibitor), member 1, (angioedema, hereditary); plasma protease C1 inhibitor; angioedema; hereditary; C1 INH; C1IN; HAE1; HAE2; serpin G1; C1-inhibiting factor; C1 esterase inhibitor; complement component 1 inhibitor; serine/cysteine proteinase inhibitor clade G member 1; C1NH; C1INH; |
Gene ID | 710 |
mRNA Refseq | NM_000062 |
Protein Refseq | NP_000053 |
MIM | 606860 |
UniProt ID | P05155 |
◆ Recombinant Proteins | ||
Serping1-282M | Recombinant Mouse Serping1 Protein, His-tagged | +Inquiry |
SERPING1-5345R | Recombinant Rat SERPING1 Protein | +Inquiry |
SERPING1-14963M | Recombinant Mouse SERPING1 Protein | +Inquiry |
SERPING1-6673Z | Recombinant Zebrafish SERPING1 | +Inquiry |
SERPING1-999H | Recombinant Full Length Human SERPING1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
SERPING1-73H | Native Human C1 Esterase inhibitor | +Inquiry |
SERPING1-97H | Active Native Human C1 Esterase Inhibitor (C1-INH) | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPING1-2615HCL | Recombinant Human SERPING1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPING1 Products
Required fields are marked with *
My Review for All SERPING1 Products
Required fields are marked with *