Recombinant Human SERPING1 protein(31-100 aa), C-His-tagged

• Cat.No.: SERPING1-2557H
• Product Overview: Recombinant Human SERPING1 protein(P05155)(31-100 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 31-100 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: SQDPESLQDRGEGKVATTVISKMLFVEPILEVSSLPTTNSTTNSATKITANTTDEPTTQPTTEPTTQPTI

Gene Information

• Gene Name: SERPING1 serpin peptidase inhibitor, clade G (C1 inhibitor), member 1 [ Homo sapiens ]
• Official Symbol: SERPING1
• Synonyms: SERPING1; serpin peptidase inhibitor, clade G (C1 inhibitor), member 1; C1NH, serine (or cysteine) proteinase inhibitor, clade G (C1 inhibitor), member 1, (angioedema, hereditary); plasma protease C1 inhibitor; angioedema; hereditary; C1 INH; C1IN; HAE1; HAE2; serpin G1; C1-inhibiting factor; C1 esterase inhibitor; complement component 1 inhibitor; serine/cysteine proteinase inhibitor clade G member 1; C1NH; C1INH
• Gene ID: 710
• mRNA Refseq: NM_000062
• Protein Refseq: NP_000053
• MIM: 606860
• UniProt ID: P05155