Recombinant Human SERPINI1 protein, His-tagged
Cat.No. : | SERPINI1-3658H |
Product Overview : | Recombinant Human SERPINI1 protein(109-410 aa), fused to His tag, was expressed in E. coli. |
Availability | September 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 109-410 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | ANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLYDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SERPINI1 serpin peptidase inhibitor, clade I (neuroserpin), member 1 [ Homo sapiens ] |
Official Symbol | SERPINI1 |
Synonyms | SERPINI1; serpin peptidase inhibitor, clade I (neuroserpin), member 1; PI12, serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1; neuroserpin; PI-12; serpin I1; peptidase inhibitor 12; serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 1; PI12; DKFZp781N13156; |
Gene ID | 5274 |
mRNA Refseq | NM_001122752 |
Protein Refseq | NP_001116224 |
MIM | 602445 |
UniProt ID | Q99574 |
◆ Recombinant Proteins | ||
SERPINI1-8003H | Recombinant Human SERPINI1 protein, His & T7-tagged | +Inquiry |
SERPINI1-3973R | Recombinant Rhesus Macaque SERPINI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SERPINI1-3658H | Recombinant Human SERPINI1 protein, His-tagged | +Inquiry |
SERPINI1-2345H | Recombinant Full Length Human SERPINI1 protein, His-tagged | +Inquiry |
SERPINI1-6982Z | Recombinant Zebrafish SERPINI1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SERPINI1-2566HCL | Recombinant Human SERPINI1 cell lysate | +Inquiry |
SERPINI1-1658MCL | Recombinant Mouse SERPINI1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERPINI1 Products
Required fields are marked with *
My Review for All SERPINI1 Products
Required fields are marked with *