Recombinant Human SETBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SETBP1-6550H
Product Overview : SETBP1 MS Standard C13 and N15-labeled recombinant protein (NP_001123582) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein which contains a several motifs including a ski homology region and a SET-binding region in addition to three nuclear localization signals. The encoded protein has been shown to bind the SET nuclear oncogene which is involved in DNA replication. Mutations in this gene are associated with Schinzel-Giedion midface retraction syndrome. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 26.2 kDa
AA Sequence : MESRETLSSSRQRGGESDFLPVSSAKPPAAPGCAGEPLLSTPGPGKGIPVGGERMEPEEEDELGSGRDVDSNSNADSEKWVAGDGLEEQEFSIKEANFTEGSLKLKIQTTKRAKKPPKNLENYICPPEIKITIKQSGDQKVSRAGKNSKATKEEERSHSKKKLLTASDLAASDLKGFQPQIKDSSKEEVWKRRGGQGIPFKKQFLSQERAMCFSCPRNPFPAKPGSLTLPFHSEPAVWAQEVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SETBP1 SET binding protein 1 [ Homo sapiens (human) ]
Official Symbol SETBP1
Synonyms SETBP1; SET binding protein 1; SET-binding protein; KIAA0437; SEB; DKFZp666J1210;
Gene ID 26040
mRNA Refseq NM_001130110
Protein Refseq NP_001123582
MIM 611060
UniProt ID Q9Y6X0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SETBP1 Products

Required fields are marked with *

My Review for All SETBP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon