Recombinant Human SETD3, His-tagged
Cat.No. : | SETD3-30077TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 443-594 of Human SETD3 With N terminal His tag; 152 amino acids, 40 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 443-594 a.a. |
Description : | SETD3 contains 1 SET domain. The function of the SETD3 protein remains unknown. There are 3 isoforms produced by alternative splicing. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitution with 64 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVKSA AVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLP LVLRNLEEEAGVQDALNIREAISKAKATENGLVNGENS IPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE |
Gene Name | SETD3 SET domain containing 3 [ Homo sapiens ] |
Official Symbol | SETD3 |
Synonyms | SETD3; SET domain containing 3; C14orf154, chromosome 14 open reading frame 154; histone-lysine N-methyltransferase setd3; FLJ23027; |
Gene ID | 84193 |
mRNA Refseq | NM_032233 |
Protein Refseq | NP_115609 |
Uniprot ID | Q86TU7 |
Chromosome Location | 14q32.2 |
Function | histone methyltransferase activity (H3-K36 specific); methyltransferase activity; transcription coactivator activity; transferase activity; |
◆ Recombinant Proteins | ||
SETD3-2943H | Recombinant Human SETD3 protein, His-tagged | +Inquiry |
SETD3-30077TH | Recombinant Human SETD3, His-tagged | +Inquiry |
Setd3-5799M | Recombinant Mouse Setd3 Protein, Myc/DDK-tagged | +Inquiry |
SETD3-4163R | Recombinant Rhesus monkey SETD3 Protein, His-tagged | +Inquiry |
SETD3-1985H | Recombinant Human SETD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SETD3-1927HCL | Recombinant Human SETD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SETD3 Products
Required fields are marked with *
My Review for All SETD3 Products
Required fields are marked with *
0
Inquiry Basket