Recombinant Human SETD3, His-tagged
| Cat.No. : | SETD3-30077TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 443-594 of Human SETD3 With N terminal His tag; 152 amino acids, 40 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 443-594 a.a. |
| Description : | SETD3 contains 1 SET domain. The function of the SETD3 protein remains unknown. There are 3 isoforms produced by alternative splicing. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitution with 64 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | TTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVKSA AVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLP LVLRNLEEEAGVQDALNIREAISKAKATENGLVNGENS IPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE |
| Gene Name | SETD3 SET domain containing 3 [ Homo sapiens ] |
| Official Symbol | SETD3 |
| Synonyms | SETD3; SET domain containing 3; C14orf154, chromosome 14 open reading frame 154; histone-lysine N-methyltransferase setd3; FLJ23027; |
| Gene ID | 84193 |
| mRNA Refseq | NM_032233 |
| Protein Refseq | NP_115609 |
| Uniprot ID | Q86TU7 |
| Chromosome Location | 14q32.2 |
| Function | histone methyltransferase activity (H3-K36 specific); methyltransferase activity; transcription coactivator activity; transferase activity; |
| ◆ Recombinant Proteins | ||
| SETD3-10409Z | Recombinant Zebrafish SETD3 | +Inquiry |
| SETD3-048H | Recombinant Human SETD3 Protein, His-tagged | +Inquiry |
| SETD3-14980M | Recombinant Mouse SETD3 Protein | +Inquiry |
| SETD3-1625C | Recombinant Chicken SETD3 | +Inquiry |
| SETD3-1861HFL | Recombinant Full Length Human SETD3 Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SETD3-1927HCL | Recombinant Human SETD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SETD3 Products
Required fields are marked with *
My Review for All SETD3 Products
Required fields are marked with *
