Recombinant Human SETD3, His-tagged
Cat.No. : | SETD3-30077TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 443-594 of Human SETD3 With N terminal His tag; 152 amino acids, 40 kDa. |
- Specification
- Gene Information
- Related Products
Description : | SETD3 contains 1 SET domain. The function of the SETD3 protein remains unknown. There are 3 isoforms produced by alternative splicing. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitution with 64 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TTIEEDKSVLKNHDLSVRAKMAIKLRLGEKEILEKAVKSA AVNREYYRQQMEEKAPLPKYEESNLGLLESSVGDSRLP LVLRNLEEEAGVQDALNIREAISKAKATENGLVNGENS IPNGTRSENESLNQESKRAVEDAKGSSSDSTAGVKE |
Gene Name : | SETD3 SET domain containing 3 [ Homo sapiens ] |
Official Symbol : | SETD3 |
Synonyms : | SETD3; SET domain containing 3; C14orf154, chromosome 14 open reading frame 154; histone-lysine N-methyltransferase setd3; FLJ23027; |
Gene ID : | 84193 |
mRNA Refseq : | NM_032233 |
Protein Refseq : | NP_115609 |
Uniprot ID : | Q86TU7 |
Chromosome Location : | 14q32.2 |
Function : | histone methyltransferase activity (H3-K36 specific); methyltransferase activity; transcription coactivator activity; transferase activity; |
Products Types
◆ Recombinant Protein | ||
Setd3-5799M | Recombinant Mouse Setd3 Protein, Myc/DDK-tagged | +Inquiry |
SETD3-8068M | Recombinant Mouse SETD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SETD3-3980R | Recombinant Rhesus Macaque SETD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
SETD3-048H | Recombinant Human SETD3 Protein, His-tagged | +Inquiry |
SETD3-1985H | Recombinant Human SETD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
SETD3-1927HCL | Recombinant Human SETD3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket