Recombinant Human SETD4 protein, GST-tagged
Cat.No. : | SETD4-21H |
Product Overview : | Recombinant Human SETD4 protein(1-50 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-50 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.0). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AASequence : | MQKGKGRTSRIRRRKLCGSSESRGVNESHKSEFIELRKWLKARKFQDSNL |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
Gene Name | SETD4 SET domain containing 4 [ Homo sapiens ] |
Official Symbol | SETD4 |
Synonyms | SETD4; SET domain containing 4; C21orf18, C21orf27, chromosome 21 open reading frame 18 , chromosome 21 open reading frame 27; SET domain-containing protein 4; C21orf18; C21orf27; |
Gene ID | 54093 |
mRNA Refseq | NM_001007259 |
Protein Refseq | NP_001007260 |
UniProt ID | Q9NVD3 |
◆ Recombinant Proteins | ||
SETD4-4164R | Recombinant Rhesus monkey SETD4 Protein, His-tagged | +Inquiry |
SETD4-20H | Recombinant Human SETD4 protein, His-tagged | +Inquiry |
SETD4-2493C | Recombinant Chicken SETD4 | +Inquiry |
SETD4-21H | Recombinant Human SETD4 protein, GST-tagged | +Inquiry |
SETD4-2798M | Recombinant Mouse SETD4 Protein (1-439 aa), His-tagged | +Inquiry |
◆ Native Proteins | ||
SETD4-998H | Recombinant Full Length Human SETD4 Protein, GST&His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SETD4-1926HCL | Recombinant Human SETD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SETD4 Products
Required fields are marked with *
My Review for All SETD4 Products
Required fields are marked with *
0
Inquiry Basket