Recombinant Human SETD4 Protein, His&ABP tagged
Cat.No. : | SETD4-36H |
Product Overview : | Recombinant Human SETD4 Protein (330-435 aa) with His&ABP tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | ABP&His |
Protein Length : | 330-435 aa |
Description : | Enables histone H4K20 methyltransferase activity. Predicted to be involved in several processes, including positive regulation of inflammatory response; positive regulation of macromolecule biosynthetic process; and regulation of cell proliferation in bone marrow. Located in cytosol and nucleus. |
Form : | Liquid |
AASequence : | LTFGWDGPSWRLLTALKLLCLEAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETNAVLQKVSHMKDEKEALINQLTLVESLWTEELKILRASAETLHSL |
Purity : | > 80% by SDS-PAGE and Coomassie blue staining |
Application : | Control (Ctrl); Blocking Assay (BLOCK) |
Storage : | At -20 centigrade, Avoid Freeze/Thaw Cycles |
Storage Buffer : | PBS/1M urea, pH 7.4 |
Concentration : | ≥5.0 mg/mL |
Shipping : | Wet ice |
Gene Name | SETD4 SET domain containing 4 [ Homo sapiens (human) ] |
Official Symbol | SETD4 |
Synonyms | SETD4; SET domain containing 4; C21orf18; C21orf27; SET domain-containing protein 4; EC 2.1.1.364 |
Gene ID | 54093 |
mRNA Refseq | NM_017438 |
Protein Refseq | NP_059134 |
MIM | 620995 |
UniProt ID | Q9NVD3 |
◆ Recombinant Proteins | ||
SETD4-4421Z | Recombinant Zebrafish SETD4 | +Inquiry |
SETD4-2493C | Recombinant Chicken SETD4 | +Inquiry |
SETD4-4164R | Recombinant Rhesus monkey SETD4 Protein, His-tagged | +Inquiry |
SETD4-3981R | Recombinant Rhesus Macaque SETD4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SETD4-21H | Recombinant Human SETD4 protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SETD4-35HFL | Recombinant Full Length Human SETD4 Protein, GST tagged | +Inquiry |
SETD4-32HFL | Recombinant Full Length Human SETD4 Protein, Flag tagged | +Inquiry |
SETD4-998H | Recombinant Full Length Human SETD4 Protein, GST&His tagged | +Inquiry |
SETD4-36H | Recombinant Human SETD4 Protein, His&ABP tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SETD4-1926HCL | Recombinant Human SETD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SETD4 Products
Required fields are marked with *
My Review for All SETD4 Products
Required fields are marked with *