Recombinant Human SETD4 Protein, His&ABP tagged

• Cat.No.: SETD4-36H
• Product Overview: Recombinant Human SETD4 Protein (330-435 aa) with His&ABP tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: ABP&His
• Protein Length: 330-435 aa
• Description: Enables histone H4K20 methyltransferase activity. Predicted to be involved in several processes, including positive regulation of inflammatory response; positive regulation of macromolecule biosynthetic process; and regulation of cell proliferation in bone marrow. Located in cytosol and nucleus.
• Form: Liquid
• AASequence: LTFGWDGPSWRLLTALKLLCLEAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETNAVLQKVSHMKDEKEALINQLTLVESLWTEELKILRASAETLHSL
• Purity: > 80% by SDS-PAGE and Coomassie blue staining
• Application: Control (Ctrl); Blocking Assay (BLOCK）
• Storage: At -20 centigrade, Avoid Freeze/Thaw Cycles
• Storage Buffer: PBS/1M urea, pH 7.4
• Concentration: ≥5.0 mg/mL
• Shipping: Wet ice

Gene Information

• Gene Name: SETD4 SET domain containing 4 [ Homo sapiens (human) ]
• Official Symbol: SETD4
• Synonyms: SETD4; SET domain containing 4; C21orf18; C21orf27; SET domain-containing protein 4; EC 2.1.1.364
• Gene ID: 54093
• mRNA Refseq: NM_017438
• Protein Refseq: NP_059134
• MIM: 620995
• UniProt ID: Q9NVD3