Recombinant Human SETD4 Protein, His&ABP tagged
| Cat.No. : | SETD4-36H |
| Product Overview : | Recombinant Human SETD4 Protein (330-435 aa) with His&ABP tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | ABP&His |
| Protein Length : | 330-435 aa |
| Description : | Enables histone H4K20 methyltransferase activity. Predicted to be involved in several processes, including positive regulation of inflammatory response; positive regulation of macromolecule biosynthetic process; and regulation of cell proliferation in bone marrow. Located in cytosol and nucleus. |
| Form : | Liquid |
| AASequence : | LTFGWDGPSWRLLTALKLLCLEAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETNAVLQKVSHMKDEKEALINQLTLVESLWTEELKILRASAETLHSL |
| Purity : | > 80% by SDS-PAGE and Coomassie blue staining |
| Application : | Control (Ctrl); Blocking Assay (BLOCK) |
| Storage : | At -20 centigrade, Avoid Freeze/Thaw Cycles |
| Storage Buffer : | PBS/1M urea, pH 7.4 |
| Concentration : | ≥5.0 mg/mL |
| Shipping : | Wet ice |
| Gene Name | SETD4 SET domain containing 4 [ Homo sapiens (human) ] |
| Official Symbol | SETD4 |
| Synonyms | SETD4; SET domain containing 4; C21orf18; C21orf27; SET domain-containing protein 4; EC 2.1.1.364 |
| Gene ID | 54093 |
| mRNA Refseq | NM_017438 |
| Protein Refseq | NP_059134 |
| MIM | 620995 |
| UniProt ID | Q9NVD3 |
| ◆ Recombinant Proteins | ||
| SETD4-4164R | Recombinant Rhesus monkey SETD4 Protein, His-tagged | +Inquiry |
| SETD4-36H | Recombinant Human SETD4 Protein, His&ABP tagged | +Inquiry |
| SETD4-35HFL | Recombinant Full Length Human SETD4 Protein, GST tagged | +Inquiry |
| SETD4-4421Z | Recombinant Zebrafish SETD4 | +Inquiry |
| SETD4-2798M | Recombinant Mouse SETD4 Protein (1-439 aa), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SETD4-1926HCL | Recombinant Human SETD4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SETD4 Products
Required fields are marked with *
My Review for All SETD4 Products
Required fields are marked with *
