Recombinant Human SF3B5 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SF3B5-3106H
• Product Overview: SF3B5 MS Standard C13 and N15-labeled recombinant protein (NP_112577) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA.
• Molecular Mass: 10.1 kDa
• AA Sequence: MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEENTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SF3B5 splicing factor 3b subunit 5 [ Homo sapiens (human) ]
• Official Symbol: SF3B5
• Synonyms: SF3B5; splicing factor 3b, subunit 5, 10kDa; splicing factor 3B subunit 5; MGC3133; SF3b10; Ysf3; pre-mRNA-splicing factor SF3b 10 kDa subunit
• Gene ID: 83443
• mRNA Refseq: NM_031287
• Protein Refseq: NP_112577
• MIM: 617847
• UniProt ID: Q9BWJ5