Recombinant Human SF3B5 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SF3B5-3106H
Product Overview : SF3B5 MS Standard C13 and N15-labeled recombinant protein (NP_112577) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA.
Molecular Mass : 10.1 kDa
AA Sequence : MTDRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEENTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SF3B5 splicing factor 3b subunit 5 [ Homo sapiens (human) ]
Official Symbol SF3B5
Synonyms SF3B5; splicing factor 3b, subunit 5, 10kDa; splicing factor 3B subunit 5; MGC3133; SF3b10; Ysf3; pre-mRNA-splicing factor SF3b 10 kDa subunit;
Gene ID 83443
mRNA Refseq NM_031287
Protein Refseq NP_112577
MIM 617847
UniProt ID Q9BWJ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SF3B5 Products

Required fields are marked with *

My Review for All SF3B5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon