Recombinant Human SFN protein(1-248aa), His-GST&Myc-tagged
Cat.No. : | SFN-4643H |
Product Overview : | Recombinant Human SFN protein(P31947)(1-248aa), fused with N-terminal His and GST and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 1-248aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 62.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS |
Gene Name | SFN stratifin [ Homo sapiens ] |
Official Symbol | SFN |
Synonyms | SFN; stratifin; 14-3-3 protein sigma; 14 3 3 sigma; YWHAS; 14-3-3 sigma; epithelial cell marker protein 1; |
Gene ID | 2810 |
mRNA Refseq | NM_006142 |
Protein Refseq | NP_006133 |
MIM | 601290 |
UniProt ID | P31947 |
◆ Recombinant Proteins | ||
SFN-4644H | Recombinant Human SFN protein(1-248aa), His&Myc-tagged | +Inquiry |
SFN-15005M | Recombinant Mouse SFN Protein | +Inquiry |
SFN-3989R | Recombinant Rhesus Macaque SFN Protein, His (Fc)-Avi-tagged | +Inquiry |
SFN-5824H | Recombinant Human SFN Protein (Met1-Ser248), N-His tagged | +Inquiry |
SFN-3857H | Recombinant Human SFN protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFN-1912HCL | Recombinant Human SFN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SFN Products
Required fields are marked with *
My Review for All SFN Products
Required fields are marked with *
0
Inquiry Basket