Recombinant Human SFPQ protein, His-tagged

• Cat.No.: SFPQ-2617H
• Product Overview: Recombinant Human SFPQ protein(1-300 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-300 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MSRDRFRSRGGGGGGFHRRGGGGGRGGLHDFRSPPPGMGLNQNRGPMGPGPGQSGPKPPIPPPPPHQQQQQPPPQQPPPQQPPPHQPPPHPQPHQQQQPPPPPQDSSKPVVAQGPGPAPGVGSTPPASSSAPPATPPTSGAPPGSGPGPTPTPPPAVTSAPPGAPPPTPPSSGVPTTPPQAGGPPPPPAAVPGPGPGPKQGPGPGGPKGGKMPGGPKPGGGPGLSTPGGHPKPPRRGGGEPRGGRQHHPPYHQQHHQGPPPGGPGGRSEEKISDSEGFKANLSLLRRPGEKTYTQRCRLF
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: SFPQ splicing factor proline/glutamine-rich [ Homo sapiens ]
• Official Symbol: SFPQ
• Synonyms: SFPQ; splicing factor proline/glutamine-rich; splicing factor proline/glutamine rich (polypyrimidine tract binding protein associated); splicing factor, proline- and glutamine-rich; polypyrimidine tract binding protein associated; PSF; hPOMp100; 100 kDa DNA-pairing protein; PTB-associated splicing factor; PTB-associated-splicing factor; DNA-binding p52/p100 complex, 100 kDa subunit; polypyrimidine tract-binding protein-associated splicing factor; polypyrimidine tract-binding protein-associated-splicing factor; splicing factor proline/glutamine rich (polypyrimidine tract-binding protein-associated); POMP100; DKFZp547C228; DKFZp667K0521; DKFZp686K1282
• Gene ID: 6421
• mRNA Refseq: NM_005066
• Protein Refseq: NP_005057
• MIM: 605199
• UniProt ID: P23246