Recombinant Human SFRP1 protein, His-tagged
Cat.No. : | SFRP1-2824H |
Product Overview : | Recombinant Human SFRP1 protein(164-250 aa), fused to His tag, was expressed in E. coli. |
Availability | August 29, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 164-250 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SFRP1 secreted frizzled-related protein 1 [ Homo sapiens ] |
Official Symbol | SFRP1 |
Synonyms | SFRP1; secreted frizzled-related protein 1; FRP; FRP 1; SARP2; SARP-2; sFRP-1; secreted apoptosis-related protein 2; FRP1; FrzA; FRP-1; |
Gene ID | 6422 |
mRNA Refseq | NM_003012 |
Protein Refseq | NP_003003 |
MIM | 604156 |
UniProt ID | Q8N474 |
◆ Recombinant Proteins | ||
SFRP1-859H | Recombinant Human SFRP1, His tagged | +Inquiry |
Sfrp1-861R | Recombinant Rat Sfrp1, Fc tagged | +Inquiry |
SFRP1-4173R | Recombinant Rhesus monkey SFRP1 Protein, His-tagged | +Inquiry |
SFRP1-364H | Recombinant Human SFRP1 Protein, His-tagged | +Inquiry |
SFRP1-8311H | Recombinant Human SFRP1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFRP1-2853HCL | Recombinant Human SFRP1 cell lysate | +Inquiry |
SFRP1-2852MCL | Recombinant Mouse SFRP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFRP1 Products
Required fields are marked with *
My Review for All SFRP1 Products
Required fields are marked with *