Recombinant Human SFRP4
| Cat.No. : | SFRP4-30079TH | 
| Product Overview : | Recombinant fragment of Human SFRP4 with N terminal proprietary tag, 36.85kDa inclusive of tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 102 amino acids | 
| Description : | Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. The expression of SFRP4 in ventricular myocardium correlates with apoptosis related gene expression. | 
| Molecular Weight : | 36.850kDa inclusive of tags | 
| Tissue specificity : | Expressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In ovarian tumors, exp | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILP HQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEER LQEQRRTVQDKKKTAGRTSRSN | 
| Sequence Similarities : | Belongs to the secreted frizzled-related protein (sFRP) family.Contains 1 FZ (frizzled) domain.Contains 1 NTR domain. | 
| Gene Name | SFRP4 secreted frizzled-related protein 4 [ Homo sapiens ] | 
| Official Symbol | SFRP4 | 
| Synonyms | SFRP4; secreted frizzled-related protein 4; FRP 4; FRPHE; frpHE; | 
| Gene ID | 6424 | 
| mRNA Refseq | NM_003014 | 
| Protein Refseq | NP_003005 | 
| MIM | 606570 | 
| Uniprot ID | Q6FHJ7 | 
| Chromosome Location | 7p14.1 | 
| Pathway | Adipogenesis, organism-specific biosystem; Wnt Signaling Pathway, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem; | 
| Function | PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; | 
| ◆ Recombinant Proteins | ||
| SFRP4-5354R | Recombinant Rat SFRP4 Protein | +Inquiry | 
| SFRP4-5013R | Recombinant Rat SFRP4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Sfrp4-863M | Recombinant Mouse Sfrp4 protein, His-tagged | +Inquiry | 
| SFRP4-30079TH | Recombinant Human SFRP4 | +Inquiry | 
| SFRP4-3991R | Recombinant Rhesus Macaque SFRP4 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SFRP4-2849MCL | Recombinant Mouse SFRP4 cell lysate | +Inquiry | 
| SFRP4-2850HCL | Recombinant Human SFRP4 cell lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFRP4 Products
Required fields are marked with *
My Review for All SFRP4 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            