Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SFRP4

Cat.No. : SFRP4-30079TH
Product Overview : Recombinant fragment of Human SFRP4 with N terminal proprietary tag, 36.85kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
Description : Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. The expression of SFRP4 in ventricular myocardium correlates with apoptosis related gene expression.
Protein length : 102 amino acids
Molecular Weight : 36.850kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in mesenchymal cells. Highly expressed in the stroma of proliferative endometrium. Expressed in cardiomyocytes. Shows moderate to strong expression in ovarian tumors with expression increasing as the tumor stage increases. In ovarian tumors, exp
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : CNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILP HQDVLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEER LQEQRRTVQDKKKTAGRTSRSN
Sequence Similarities : Belongs to the secreted frizzled-related protein (sFRP) family.Contains 1 FZ (frizzled) domain.Contains 1 NTR domain.
Gene Name : SFRP4 secreted frizzled-related protein 4 [ Homo sapiens ]
Official Symbol : SFRP4
Synonyms : SFRP4; secreted frizzled-related protein 4; FRP 4; FRPHE; frpHE;
Gene ID : 6424
mRNA Refseq : NM_003014
Protein Refseq : NP_003005
MIM : 606570
Uniprot ID : Q6FHJ7
Chromosome Location : 7p14.1
Pathway : Adipogenesis, organism-specific biosystem; Wnt Signaling Pathway, organism-specific biosystem; Wnt signaling pathway, organism-specific biosystem; Wnt signaling pathway, conserved biosystem;
Function : PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends