Recombinant Human SFTPA1 protein, His-tagged
| Cat.No. : | SFTPA1-2475H |
| Product Overview : | Recombinant Human SFTPA1 protein(132-248 aa), fused to His tag, was expressed in E. coli. |
| Availability | November 17, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 132-248 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEF |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SFTPA1 surfactant protein A1 [ Homo sapiens ] |
| Official Symbol | SFTPA1 |
| Synonyms | SFTPA1; surfactant protein A1; SFTP1, surfactant, pulmonary associated protein A1; pulmonary surfactant-associated protein A1; COLEC4; SP A; SP A1; surfactant; pulmonary associated protein A1A; collectin-4; surfactant protein A1B; alveolar proteinosis protein; surfactant protein A1 variant AD 6A; surfactant protein A1 variant AD 6A2; surfactant protein A1 variant AD 6A3; surfactant protein A1 variant AD 6A4; surfactant protein A1 variant ACD 6A2; surfactant protein A1 variant ACD 6A3; surfactant protein A1 variant ACD 6A4; surfactant protein A1 variant ABD 6A2; surfactant protein A1 variant ABD 6A3; surfactant protein A1 variant ABD 6A4; surfactant, pulmonary-associated protein A1A; surfactant, pulmonary-associated protein A1B; 35 kDa pulmonary surfactant-associated protein; SPA; PSAP; PSPA; SP-A; SPA1; PSP-A; SFTP1; SP-A1; SFTPA1B; FLJ50593; FLJ51913; FLJ61144; FLJ77898; FLJ79095; FLJ99559; MGC133365; MGC198590; |
| Gene ID | 653509 |
| mRNA Refseq | NM_001093770 |
| Protein Refseq | NP_001087239 |
| MIM | 178630 |
| UniProt ID | Q8IWL2 |
| ◆ Recombinant Proteins | ||
| SFTPA1-3395M | Recombinant Mouse SFTPA1 protein, His-tagged | +Inquiry |
| SFTPA1-1227H | Recombinant Human SFTPA1 Protein, His-tagged | +Inquiry |
| SFTPA1-2539H | Recombinant Human SFTPA1 Protein (21-248 aa), His-tagged | +Inquiry |
| SFTPA1-5016R | Recombinant Rat SFTPA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SFTPA1-1264M | Recombinant Mouse SFTPA1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFTPA1 Products
Required fields are marked with *
My Review for All SFTPA1 Products
Required fields are marked with *
