Recombinant Human SFTPA2, His-tagged
Cat.No. : | SFTPA2-188H |
Product Overview : | Recombinant Human Pulmonary Surfactant-Associated Protein A2/SFTPA2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Glu21-Phe248) of Human SFTPA2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | Pulmonary Surfactant-Associated Protein A2 (SFTPA2) is a member of the SFTPA family. SFTPA2 is a secreted protein and contains one C-type lectin domain and one collagen-like domain. In the presence of calcium ions, it binds to surfactant phospholipids and contributes to lowering the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Defects in SFTPA2 are a cause of pulmonary fibrosis idiopathic, and results in acute lung injury with subsequent scarring and endstage lung disease. |
AA Sequence : | EVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGER GEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDA IQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGE PAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEFVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
◆ Recombinant Proteins | ||
SFTPA2-188H | Recombinant Human SFTPA2, His-tagged | +Inquiry |
SFTPA2-15H | Recombinant Human SFTPA2 protein, GST-tagged | +Inquiry |
SFTPA2-4609H | Recombinant Human SFTPA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SFTPA2-3821HFL | Recombinant Full Length Human SFTPA2 protein, Flag-tagged | +Inquiry |
SFTPA2-13H | Recombinant Human SFTPA2 protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFTPA2 Products
Required fields are marked with *
My Review for All SFTPA2 Products
Required fields are marked with *