Recombinant Human SFTPA2B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SFTPA2B-798H
Product Overview : SFTPA2B MS Standard C13 and N15-labeled recombinant protein (NP_008857) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : DISCONTINUED: This record has been withdrawn by the HUGO Gene Nomenclature Committee (HGNC), and it has been determined that the sequence is redundant with SFTPA2 (GeneID:729238) in the GRCh37.1 reference assembly.
Molecular Mass : 26.2 kDa
AA Sequence : MWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SFTPA2B surfactant protein A2B [ Homo sapiens (human) ]
Official Symbol SFTPA2B
Synonyms SFTPA2B; surfactant protein A2B; SP-2A; SP-A1; SP-A2; SPAII; SFTPA2; AC068139.3; surfactant protein A2B; SP-2A beta; SP-A1 beta; surfactant pulmonary associated protein A2; surfactant, pulmonary-associated protein A2B
Gene ID 6436
mRNA Refseq NM_006926
Protein Refseq NP_008857

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFTPA2B Products

Required fields are marked with *

My Review for All SFTPA2B Products

Required fields are marked with *

0
cart-icon