Recombinant Human SFTPA2B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SFTPA2B-798H |
Product Overview : | SFTPA2B MS Standard C13 and N15-labeled recombinant protein (NP_008857) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | DISCONTINUED: This record has been withdrawn by the HUGO Gene Nomenclature Committee (HGNC), and it has been determined that the sequence is redundant with SFTPA2 (GeneID:729238) in the GRCh37.1 reference assembly. |
Molecular Mass : | 26.2 kDa |
AA Sequence : | MWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SFTPA2B surfactant protein A2B [ Homo sapiens (human) ] |
Official Symbol | SFTPA2B |
Synonyms | SFTPA2B; surfactant protein A2B; SP-2A; SP-A1; SP-A2; SPAII; SFTPA2; AC068139.3; surfactant protein A2B; SP-2A beta; SP-A1 beta; surfactant pulmonary associated protein A2; surfactant, pulmonary-associated protein A2B |
Gene ID | 6436 |
mRNA Refseq | NM_006926 |
Protein Refseq | NP_008857 |
◆ Recombinant Proteins | ||
SFTPA2B-798H | Recombinant Human SFTPA2B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFTPA2B-1899HCL | Recombinant Human SFTPA2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFTPA2B Products
Required fields are marked with *
My Review for All SFTPA2B Products
Required fields are marked with *