Recombinant Human SFTPA2B Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SFTPA2B-798H
• Product Overview: SFTPA2B MS Standard C13 and N15-labeled recombinant protein (NP_008857) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: DISCONTINUED: This record has been withdrawn by the HUGO Gene Nomenclature Committee (HGNC), and it has been determined that the sequence is redundant with SFTPA2 (GeneID:729238) in the GRCh37.1 reference assembly.
• Molecular Mass: 26.2 kDa
• AA Sequence: MWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPMGPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQTRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKKYNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLYSRLTICEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SFTPA2B surfactant protein A2B [ Homo sapiens (human) ]
• Official Symbol: SFTPA2B
• Synonyms: SFTPA2B; surfactant protein A2B; SP-2A; SP-A1; SP-A2; SPAII; SFTPA2; AC068139.3; surfactant protein A2B; SP-2A beta; SP-A1 beta; surfactant pulmonary associated protein A2; surfactant, pulmonary-associated protein A2B
• Gene ID: 6436
• mRNA Refseq: NM_006926
• Protein Refseq: NP_008857