Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SFTPC

Cat.No. : SFTPC-30425TH
Product Overview : Recombinant full length Human SFTPC with N terminal proprietary tag; Predicted MWt 47.41 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 2, also called pulmonary alveolar proteinosis due to surfactant protein C deficiency, and are associated with interstitial lung disease in older infants, children, and adults. Alternatively spliced transcript variants encoding different protein isoforms have been identified.
Protein length : 197 amino acids
Molecular Weight : 47.410kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MDVGSKEVLMESPPDYSAAPRGRFGIPRCPVHLKRLLIVV VVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQ RLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTC CYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSK LGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI
Sequence Similarities : Contains 1 BRICHOS domain.
Gene Name : SFTPC surfactant protein C [ Homo sapiens ]
Official Symbol : SFTPC
Synonyms : SFTPC; surfactant protein C; SFTP2, surfactant, pulmonary associated protein C; pulmonary surfactant-associated protein C; PSP C; SMDP2; SP C;
Gene ID : 6440
mRNA Refseq : NM_001172357
Protein Refseq : NP_001165828
MIM : 178620
Uniprot ID : P11686
Chromosome Location : 8p21
Function : protein homodimerization activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends