Recombinant Human SFTPC protein, GST-tagged
Cat.No. : | SFTPC-3490H |
Product Overview : | Recombinant Human SFTPC protein(P11686)(24-58aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 24-58aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 30.7 kDa |
AA Sequence : | FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SFTPC surfactant protein C [ Homo sapiens ] |
Official Symbol | SFTPC |
Synonyms | SFTPC; surfactant protein C; SFTP2, surfactant, pulmonary associated protein C; pulmonary surfactant-associated protein C; PSP C; SMDP2; SP C; SP5; pulmonary surfactant apoprotein-2 SP-C; pulmonary surfactant-associated proteolipid SPL(Val); SP-C; PSP-C; SFTP2; |
Gene ID | 6440 |
mRNA Refseq | NM_001172357 |
Protein Refseq | NP_001165828 |
MIM | 178620 |
UniProt ID | P11686 |
◆ Recombinant Proteins | ||
SFTPC-810B | Recombinant Bovine SFTPC Protein (25-58 aa), GST-tagged | +Inquiry |
Sftpc-1722M | Recombinant Mouse Sftpc protein, His-tagged | +Inquiry |
SFTPC-1517H | Recombinant Human SFTPC Protein (24-58 aa), His-tagged | +Inquiry |
Sftpc-1723R | Recombinant Rat Sftpc protein, His & GST-tagged | +Inquiry |
SFTPC-475HF | Recombinant Full Length Human SFTPC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFTPC-1896HCL | Recombinant Human SFTPC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFTPC Products
Required fields are marked with *
My Review for All SFTPC Products
Required fields are marked with *
0
Inquiry Basket