Recombinant Human SFTPC protein, GST-tagged

Cat.No. : SFTPC-3490H
Product Overview : Recombinant Human SFTPC protein(P11686)(24-58aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 24-58aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 30.7 kDa
AA Sequence : FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SFTPC surfactant protein C [ Homo sapiens ]
Official Symbol SFTPC
Synonyms SFTPC; surfactant protein C; SFTP2, surfactant, pulmonary associated protein C; pulmonary surfactant-associated protein C; PSP C; SMDP2; SP C; SP5; pulmonary surfactant apoprotein-2 SP-C; pulmonary surfactant-associated proteolipid SPL(Val); SP-C; PSP-C; SFTP2;
Gene ID 6440
mRNA Refseq NM_001172357
Protein Refseq NP_001165828
MIM 178620
UniProt ID P11686

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFTPC Products

Required fields are marked with *

My Review for All SFTPC Products

Required fields are marked with *

0
cart-icon