Recombinant Human SFTPC protein, GST-tagged

• Cat.No.: SFTPC-3490H
• Product Overview: Recombinant Human SFTPC protein(P11686)(24-58aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 30.7 kDa
• Protein length: 24-58aa
• AA Sequence: FGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGL
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SFTPC surfactant protein C [ Homo sapiens ]
• Official Symbol: SFTPC
• Synonyms: SFTPC; surfactant protein C; SFTP2, surfactant, pulmonary associated protein C; pulmonary surfactant-associated protein C; PSP C; SMDP2; SP C; SP5; pulmonary surfactant apoprotein-2 SP-C; pulmonary surfactant-associated proteolipid SPL(Val); SP-C; PSP-C; SFTP2
• Gene ID: 6440
• mRNA Refseq: NM_001172357
• Protein Refseq: NP_001165828
• MIM: 178620
• UniProt ID: P11686