Recombinant Human SFTPC Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SFTPC-4700H |
Product Overview : | SFTPC MS Standard C13 and N15-labeled recombinant protein (NP_003009) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 2, also called pulmonary alveolar proteinosis due to surfactant protein C deficiency, and are associated with interstitial lung disease in older infants, children, and adults. Alternatively spliced transcript variants encoding different protein isoforms have been identified. |
Molecular Mass : | 21.1 kDa |
AA Sequence : | MDVGSKEVLMESPPDYSAAPRGRFGIPCCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SFTPC surfactant protein C [ Homo sapiens (human) ] |
Official Symbol | SFTPC |
Synonyms | SFTPC; surfactant protein C; SFTP2, surfactant, pulmonary associated protein C; pulmonary surfactant-associated protein C; PSP C; SMDP2; SP C; SP5; pulmonary surfactant apoprotein-2 SP-C; pulmonary surfactant-associated proteolipid SPL(Val); SP-C; PSP-C; SFTP2; |
Gene ID | 6440 |
mRNA Refseq | NM_003018 |
Protein Refseq | NP_003009 |
MIM | 178620 |
UniProt ID | P11686 |
◆ Recombinant Proteins | ||
SFTPC-6269H | Recombinant Human SFTPC Protein (Phe24-Ile197), N-GST tagged | +Inquiry |
SFTPC-475HF | Recombinant Full Length Human SFTPC Protein | +Inquiry |
SFTPC-3489B | Recombinant Bovine SFTPC protein, His-GST-tagged | +Inquiry |
SFTPC-9988HFL | Recombinant Full Length Human SFTPC protein, Flag-tagged | +Inquiry |
SFTPC-810B | Recombinant Bovine SFTPC Protein (25-58 aa), GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFTPC-1896HCL | Recombinant Human SFTPC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SFTPC Products
Required fields are marked with *
My Review for All SFTPC Products
Required fields are marked with *
0
Inquiry Basket