Recombinant Human SGCD

• Cat.No.: SGCD-26997TH
• Product Overview: Recombinant fragment of Human delta Sarcoglycan protein with an N terminal proprietary tag; Predicted MW 33.99 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 76 amino acids
• Description: The protein encoded by this gene is one of the four known components of the sarcoglycan complex, which is a subcomplex of the dystrophin-glycoprotein complex (DGC). DGC forms a link between the F-actin cytoskeleton and the extracellular matrix. This protein is expressed most abundantly in skeletal and cardiac muscle. Mutations in this gene have been associated with autosomal recessive limb-girdle muscular dystrophy and dilated cardiomyopathy. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene.
• Molecular Weight: 33.990kDa
• Tissue specificity: Most strongly expressed in skeletal and cardiac muscle. Also detected in smooth muscle. Weak expression in brain and lung.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: ILNDQTKVLTQLITGPKAVEAYGKKFEVKTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFK
• Sequence Similarities: Belongs to the sarcoglycan beta/delta/gamma/zeta family.

Gene Information

• Gene Name: SGCD sarcoglycan, delta (35kDa dystrophin-associated glycoprotein) [ Homo sapiens ]
• Official Symbol: SGCD
• Synonyms: SGCD; sarcoglycan, delta (35kDa dystrophin-associated glycoprotein); sarcoglycan, delta (35kD dystrophin associated glycoprotein); delta-sarcoglycan; CMD1L; DAGD; LGMD2F
• Gene ID: 6444
• mRNA Refseq: NM_000337
• Protein Refseq: NP_000328
• MIM: 601411
• Uniprot ID: Q92629
• Chromosome Location: 5q33-q34
• Pathway: Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem