Recombinant Human SGCD
Cat.No. : | SGCD-26997TH |
Product Overview : | Recombinant fragment of Human delta Sarcoglycan protein with an N terminal proprietary tag; Predicted MW 33.99 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 76 amino acids |
Description : | The protein encoded by this gene is one of the four known components of the sarcoglycan complex, which is a subcomplex of the dystrophin-glycoprotein complex (DGC). DGC forms a link between the F-actin cytoskeleton and the extracellular matrix. This protein is expressed most abundantly in skeletal and cardiac muscle. Mutations in this gene have been associated with autosomal recessive limb-girdle muscular dystrophy and dilated cardiomyopathy. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. |
Molecular Weight : | 33.990kDa |
Tissue specificity : | Most strongly expressed in skeletal and cardiac muscle. Also detected in smooth muscle. Weak expression in brain and lung. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ILNDQTKVLTQLITGPKAVEAYGKKFEVKTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFK |
Sequence Similarities : | Belongs to the sarcoglycan beta/delta/gamma/zeta family. |
Gene Name | SGCD sarcoglycan, delta (35kDa dystrophin-associated glycoprotein) [ Homo sapiens ] |
Official Symbol | SGCD |
Synonyms | SGCD; sarcoglycan, delta (35kDa dystrophin-associated glycoprotein); sarcoglycan, delta (35kD dystrophin associated glycoprotein); delta-sarcoglycan; CMD1L; DAGD; LGMD2F; |
Gene ID | 6444 |
mRNA Refseq | NM_000337 |
Protein Refseq | NP_000328 |
MIM | 601411 |
Uniprot ID | Q92629 |
Chromosome Location | 5q33-q34 |
Pathway | Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem; |
◆ Recombinant Proteins | ||
SGCD-231Z | Recombinant Zebrafish SGCD | +Inquiry |
RFL34343MF | Recombinant Full Length Mesocricetus Auratus Delta-Sarcoglycan(Sgcd) Protein, His-Tagged | +Inquiry |
SGCD-8097M | Recombinant Mouse SGCD Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL7088MF | Recombinant Full Length Mouse Delta-Sarcoglycan(Sgcd) Protein, His-Tagged | +Inquiry |
SGCD-15030M | Recombinant Mouse SGCD Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGCD-1888HCL | Recombinant Human SGCD 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGCD Products
Required fields are marked with *
My Review for All SGCD Products
Required fields are marked with *