Recombinant Human SGCG
| Cat.No. : | SGCG-28970TH |
| Product Overview : | Recombinant full length Human gamma Sarcoglycan with N terminal proprietary tag; Predicted MWt 58.08 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 291 amino acids |
| Description : | This gene encodes gamma-sarcoglycan, one of several sarcolemmal transmembrane glycoproteins that interact with dystrophin. The dystrophin-glycoprotein complex (DGC) spans the sarcolemma and is comprised of dystrophin, syntrophin, alpha- and beta-dystroglycans and sarcoglycans. The DGC provides a structural link between the subsarcolemmal cytoskeleton and the extracellular matrix of muscle cells. Defects in the encoded protein can lead to early onset autosomal recessive muscular dystrophy, in particular limb-girdle muscular dystrophy, type 2C (LGMD2C). |
| Molecular Weight : | 58.080kDa inclusive of tags |
| Tissue specificity : | Expressed in skeletal and heart muscle. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFV LLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRL EGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEG EVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVV GTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRS LSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAE TVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVS TTCQEHSHICL |
| Sequence Similarities : | Belongs to the sarcoglycan beta/delta/gamma/zeta family. |
| Gene Name | SGCG sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein) [ Homo sapiens ] |
| Official Symbol | SGCG |
| Synonyms | SGCG; sarcoglycan, gamma (35kDa dystrophin-associated glycoprotein); DMDA1, LGMD2C, MAM, sarcoglycan, gamma (35kD dystrophin associated glycoprotein); gamma-sarcoglycan; 35kD dystrophin associated glycoprotein; A4; DAGA4; DMDA; gamma sarcoglycan; limb gi |
| Gene ID | 6445 |
| mRNA Refseq | NM_000231 |
| Protein Refseq | NP_000222 |
| MIM | 608896 |
| Uniprot ID | Q13326 |
| Chromosome Location | 13q12-q13 |
| Pathway | Arrhythmogenic right ventricular cardiomyopathy (ARVC), organism-specific biosystem; Arrhythmogenic right ventricular cardiomyopathy (ARVC), conserved biosystem; Dilated cardiomyopathy, organism-specific biosystem; Dilated cardiomyopathy, conserved biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem; |
| ◆ Recombinant Proteins | ||
| SGCG-1087Z | Recombinant Zebrafish SGCG | +Inquiry |
| SGCG-1996H | Recombinant Human SGCG Protein, His (Fc)-Avi-tagged | +Inquiry |
| SGCG-26403TH | Recombinant Human SGCG | +Inquiry |
| SGCG-15032M | Recombinant Mouse SGCG Protein | +Inquiry |
| RFL29667MF | Recombinant Full Length Mouse Gamma-Sarcoglycan(Sgcg) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SGCG-1887HCL | Recombinant Human SGCG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGCG Products
Required fields are marked with *
My Review for All SGCG Products
Required fields are marked with *
