Recombinant Human SGPL1 protein, His-tagged
Cat.No. : | SGPL1-2874H |
Product Overview : | Recombinant Human SGPL1 protein(69 - 281 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 69 - 281 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SGPL1 sphingosine-1-phosphate lyase 1 [ Homo sapiens ] |
Official Symbol | SGPL1 |
Synonyms | SGPL1; sphingosine-1-phosphate lyase 1; SPL; hSPL; SPL 1; SP-lyase 1; sphingosine-1-phosphate aldolase; S1PL; FLJ13811; KIAA1252; |
Gene ID | 8879 |
mRNA Refseq | NM_003901 |
Protein Refseq | NP_003892 |
MIM | 603729 |
UniProt ID | O95470 |
◆ Recombinant Proteins | ||
SGPL1-711HFL | Recombinant Full Length Human SGPL1 Protein, C-Flag-tagged | +Inquiry |
SGPL1-8107M | Recombinant Mouse SGPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SGPL1-501H | Recombinant Human SGPL1, His-tagged | +Inquiry |
Sgpl1-5828M | Recombinant Mouse Sgpl1 Protein, Myc/DDK-tagged | +Inquiry |
SGPL1-5368R | Recombinant Rat SGPL1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGPL1-1595HCL | Recombinant Human SGPL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGPL1 Products
Required fields are marked with *
My Review for All SGPL1 Products
Required fields are marked with *
0
Inquiry Basket