Recombinant Human SGPL1 protein, His-tagged
| Cat.No. : | SGPL1-2874H |
| Product Overview : | Recombinant Human SGPL1 protein(69-281 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 13, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 69-281 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTA |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SGPL1 sphingosine-1-phosphate lyase 1 [ Homo sapiens ] |
| Official Symbol | SGPL1 |
| Synonyms | SGPL1; sphingosine-1-phosphate lyase 1; SPL; hSPL; SPL 1; SP-lyase 1; sphingosine-1-phosphate aldolase; S1PL; FLJ13811; KIAA1252; |
| Gene ID | 8879 |
| mRNA Refseq | NM_003901 |
| Protein Refseq | NP_003892 |
| MIM | 603729 |
| UniProt ID | O95470 |
| ◆ Recombinant Proteins | ||
| SGPL1-2874H | Recombinant Human SGPL1 protein, His-tagged | +Inquiry |
| RFL15852HF | Recombinant Full Length Human Sphingosine-1-Phosphate Lyase 1(Sgpl1) Protein, His-Tagged | +Inquiry |
| Sgpl1-5828M | Recombinant Mouse Sgpl1 Protein, Myc/DDK-tagged | +Inquiry |
| SGPL1-3141H | Recombinant Human SGPL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SGPL1-1805C | Recombinant Chicken SGPL1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SGPL1-1595HCL | Recombinant Human SGPL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGPL1 Products
Required fields are marked with *
My Review for All SGPL1 Products
Required fields are marked with *
