Recombinant Human SGPL1 protein, His-tagged
Cat.No. : | SGPL1-2874H |
Product Overview : | Recombinant Human SGPL1 protein(69-281 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 69-281 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MRFKKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFWQEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGGTESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNTA |
Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | SGPL1 sphingosine-1-phosphate lyase 1 [ Homo sapiens ] |
Official Symbol | SGPL1 |
Synonyms | SGPL1; sphingosine-1-phosphate lyase 1; SPL; hSPL; SPL 1; SP-lyase 1; sphingosine-1-phosphate aldolase; S1PL; FLJ13811; KIAA1252; |
Gene ID | 8879 |
mRNA Refseq | NM_003901 |
Protein Refseq | NP_003892 |
MIM | 603729 |
UniProt ID | O95470 |
◆ Recombinant Proteins | ||
SGPL1-5577Z | Recombinant Zebrafish SGPL1 | +Inquiry |
SGPL1-5368R | Recombinant Rat SGPL1 Protein | +Inquiry |
Sgpl1-5828M | Recombinant Mouse Sgpl1 Protein, Myc/DDK-tagged | +Inquiry |
SGPL1-15042M | Recombinant Mouse SGPL1 Protein | +Inquiry |
Sgpl1-1298M | Recombinant Mouse Sgpl1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGPL1-1595HCL | Recombinant Human SGPL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGPL1 Products
Required fields are marked with *
My Review for All SGPL1 Products
Required fields are marked with *