Recombinant Full Length Human SGPL1 Protein, C-Flag-tagged
Cat.No. : | SGPL1-711HFL |
Product Overview : | Recombinant Full Length Human SGPL1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables sphinganine-1-phosphate aldolase activity. Involved in apoptotic signaling pathway; fatty acid metabolic process; and sphingolipid metabolic process. Located in endoplasmic reticulum. Implicated in nephrotic syndrome type 14. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 63.3 kDa |
AA Sequence : | MPSTDLLMLKAFEPYLEILEVYSTKAKNYVNGHCTKYEPWQLIAWSVVWTLLIVWGYEFVFQPESLWSRF KKKCFKLTRKMPIIGRKIQDKLNKTKDDISKNMSFLKVDKEYVKALPSQGLSSSAVLEKLKEYSSMDAFW QEGRASGTVYSGEEKLTELLVKAYGDFAWSNPLHPDIFPGLRKIEAEIVRIACSLFNGGPDSCGCVTSGG TESILMACKAYRDLAFEKGIKTPEIVAPQSAHAAFNKAASYFGMKIVRVPLTKMMEVDVRAMRRAISRNT AMLVCSTPQFPHGVIDPVPEVAKLAVKYKIPLHVDACLGGFLIVFMEKAGYPLEHPFDFRVKGVTSISAD THKYGYAPKGSSLVLYSDKKYRNYQFFVDTDWQGGIYASPTIAGSRPGGISAACWAALMHFGENGYVEAT KQIIKTARFLKSELENIKGIFVFGNPQLSVIALGSRDFDIYRLSNLMTAKGWNLNQLQFPPSIHFCITLL HARKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQTTVDRNMVAELSSVFLDSLYSTDTVTQGSQ MNGSPKPHTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Sphingolipid metabolism |
Full Length : | Full L. |
Gene Name | SGPL1 sphingosine-1-phosphate lyase 1 [ Homo sapiens (human) ] |
Official Symbol | SGPL1 |
Synonyms | SPL; S1PL; NPHS14 |
Gene ID | 8879 |
mRNA Refseq | NM_003901.4 |
Protein Refseq | NP_003892.2 |
MIM | 603729 |
UniProt ID | O95470 |
◆ Recombinant Proteins | ||
SGPL1-711HFL | Recombinant Full Length Human SGPL1 Protein, C-Flag-tagged | +Inquiry |
SGPL1-8107M | Recombinant Mouse SGPL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SGPL1-1805C | Recombinant Chicken SGPL1 | +Inquiry |
RFL15852HF | Recombinant Full Length Human Sphingosine-1-Phosphate Lyase 1(Sgpl1) Protein, His-Tagged | +Inquiry |
Sgpl1-1298M | Recombinant Mouse Sgpl1 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGPL1-1595HCL | Recombinant Human SGPL1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SGPL1 Products
Required fields are marked with *
My Review for All SGPL1 Products
Required fields are marked with *
0
Inquiry Basket