Recombinant Human SGSH protein, GST-tagged
Cat.No. : | SGSH-301590H |
Product Overview : | Recombinant Human SGSH (152-502 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ile152-Leu502 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | ITRIKLLVRKFLQTQDDRPFFLYVAFHDPHRCGHSQPQYGTFCEKFGNGESGMGRIPDWTPQAYDPLDVLVPYFVPNTPAARADLAAQYTTVGRMDQGVGLVLQELRDAGVLNDTLVIFTSDNGIPFPSGRTNLYWPGTAEPLLVSSPEHPKRWGQVSEAYVSLLDLTPTILDWFSIPYPSYAIFGSKTIHLTGRSLLPALEAEPLWATVFGSQSHHEVTMSYPMRSVQHRHFRLVHNLNFKMPFPIDQDFYVSPTFQDLLNRTTAGQPTGWYKDLRHYYYRARWELYDRSRDPHETQNLATDPRFAQLLEMLRDQLAKWQWETHDPWVCAPDGVLEEKLSPQCQPLHNEL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | SGSH N-sulfoglucosamine sulfohydrolase [ Homo sapiens ] |
Official Symbol | SGSH |
Synonyms | SGSH; N-sulfoglucosamine sulfohydrolase; N-sulphoglucosamine sulphohydrolase; HSS; MPS3A; mucopolysaccharidosis type IIIA; SFMD; sulfamidase; sulphamidase; heparan sulfate sulfatase; sulfoglucosamine sulfamidase; |
Gene ID | 6448 |
mRNA Refseq | NM_000199 |
Protein Refseq | NP_000190 |
MIM | 605270 |
UniProt ID | P51688 |
◆ Recombinant Proteins | ||
SGSH-6275H | Recombinant Human SGSH Protein (Arg21-Leu502), C-His tagged | +Inquiry |
SGSH-2634H | Recombinant Human SGSH, His-tagged | +Inquiry |
SGSH-6660Z | Recombinant Zebrafish SGSH | +Inquiry |
SGSH-195H | Recombinant Human SGSH protein, His-tagged | +Inquiry |
Sgsh-5829M | Recombinant Mouse Sgsh Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGSH-1884HCL | Recombinant Human SGSH 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGSH Products
Required fields are marked with *
My Review for All SGSH Products
Required fields are marked with *