Recombinant Human SGSM3 protein, His-tagged

• Cat.No.: SGSM3-3129H
• Product Overview: Recombinant Human SGSM3 protein(1-210 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-210 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: MSGSHTPACGPFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAAC
• Purity: 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SGSM3 small G protein signaling modulator 3 [ Homo sapiens ]
• Official Symbol: SGSM3
• Synonyms: SGSM3; small G protein signaling modulator 3; RUN and TBC1 domain containing 3 , RUTBC3; DJ1042K10.2; RabGAP 5; RABGAP5; RUN and SH3 containing 3; RUSC3; rabGAPLP; merlin binding protein; merlin-associated protein; RUN and TBC1 domain containing 3; RUN and TBC1 domain-containing protein 3; rab-GTPase-activating protein-like protein; small G protein signaling modulator 3 protein; MAP; RUTBC3; RabGAP-5; DKFZp761D051
• Gene ID: 27352
• mRNA Refseq: NM_015705
• Protein Refseq: NP_056520
• MIM: 610440
• UniProt ID: Q96HU1