Recombinant Human SGSM3 protein, His-tagged

Cat.No. : SGSM3-3129H
Product Overview : Recombinant Human SGSM3 protein(1-210 aa), fused to His tag, was expressed in E. coli.
Availability July 07, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-210 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : MSGSHTPACGPFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAAC
Purity : 98%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SGSM3 small G protein signaling modulator 3 [ Homo sapiens ]
Official Symbol SGSM3
Synonyms SGSM3; small G protein signaling modulator 3; RUN and TBC1 domain containing 3 , RUTBC3; DJ1042K10.2; RabGAP 5; RABGAP5; RUN and SH3 containing 3; RUSC3; rabGAPLP; merlin binding protein; merlin-associated protein; RUN and TBC1 domain containing 3; RUN and TBC1 domain-containing protein 3; rab-GTPase-activating protein-like protein; small G protein signaling modulator 3 protein; MAP; RUTBC3; RabGAP-5; DKFZp761D051;
Gene ID 27352
mRNA Refseq NM_015705
Protein Refseq NP_056520
MIM 610440
UniProt ID Q96HU1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SGSM3 Products

Required fields are marked with *

My Review for All SGSM3 Products

Required fields are marked with *

0
cart-icon