Recombinant Human SGSM3 protein, His-tagged
Cat.No. : | SGSM3-3129H |
Product Overview : | Recombinant Human SGSM3 protein(1-210 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-210 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSGSHTPACGPFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSSLLANSPLMEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAAC |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SGSM3 small G protein signaling modulator 3 [ Homo sapiens ] |
Official Symbol | SGSM3 |
Synonyms | SGSM3; small G protein signaling modulator 3; RUN and TBC1 domain containing 3 , RUTBC3; DJ1042K10.2; RabGAP 5; RABGAP5; RUN and SH3 containing 3; RUSC3; rabGAPLP; merlin binding protein; merlin-associated protein; RUN and TBC1 domain containing 3; RUN and TBC1 domain-containing protein 3; rab-GTPase-activating protein-like protein; small G protein signaling modulator 3 protein; MAP; RUTBC3; RabGAP-5; DKFZp761D051; |
Gene ID | 27352 |
mRNA Refseq | NM_015705 |
Protein Refseq | NP_056520 |
MIM | 610440 |
UniProt ID | Q96HU1 |
◆ Recombinant Proteins | ||
SGSM3-4819H | Recombinant Human SGSM3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SGSM3-2635H | Recombinant Human SGSM3, GST-tagged | +Inquiry |
SGSM3-3129H | Recombinant Human SGSM3 protein, His-tagged | +Inquiry |
SGSM3-12515Z | Recombinant Zebrafish SGSM3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
SGSM3-1883HCL | Recombinant Human SGSM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SGSM3 Products
Required fields are marked with *
My Review for All SGSM3 Products
Required fields are marked with *