Recombinant Human SH2D6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SH2D6-5355H
• Product Overview: SH2D6 MS Standard C13 and N15-labeled recombinant protein (NP_940884) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SH2D6 (SH2 Domain Containing 6) is a Protein Coding gene. Diseases associated with SH2D6 include Deafness, Autosomal Recessive 88. An important paralog of this gene is BLNK.
• Molecular Mass: 19.1 kDa
• AA Sequence: MYASSYPPPPQLSPRSHLCPPPPHPTPPQLNNLLLLEGRKSSLPSVAPTGSASAAEDSDLLTQPWYSGNCDRYAVESALLHLQKDGAYTVRPSSGPHGSQPFTLAVLLRGRVFNIPIRRLDGGRHYALGREGRNREELFSSVAAMVQHFMWHPLPLVDRHSGSRELTCLLFPTKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SH2D6 SH2 domain containing 6 [ Homo sapiens (human) ]
• Official Symbol: SH2D6
• Synonyms: SH2D6; SH2 domain containing 6; SH2 domain-containing protein 6
• Gene ID: 284948
• mRNA Refseq: NM_198482
• Protein Refseq: NP_940884
• UniProt ID: B3KSC4