Recombinant Human SH2D6 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SH2D6-5355H |
| Product Overview : | SH2D6 MS Standard C13 and N15-labeled recombinant protein (NP_940884) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | SH2D6 (SH2 Domain Containing 6) is a Protein Coding gene. Diseases associated with SH2D6 include Deafness, Autosomal Recessive 88. An important paralog of this gene is BLNK. |
| Molecular Mass : | 19.1 kDa |
| AA Sequence : | MYASSYPPPPQLSPRSHLCPPPPHPTPPQLNNLLLLEGRKSSLPSVAPTGSASAAEDSDLLTQPWYSGNCDRYAVESALLHLQKDGAYTVRPSSGPHGSQPFTLAVLLRGRVFNIPIRRLDGGRHYALGREGRNREELFSSVAAMVQHFMWHPLPLVDRHSGSRELTCLLFPTKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SH2D6 SH2 domain containing 6 [ Homo sapiens (human) ] |
| Official Symbol | SH2D6 |
| Synonyms | SH2D6; SH2 domain containing 6; SH2 domain-containing protein 6 |
| Gene ID | 284948 |
| mRNA Refseq | NM_198482 |
| Protein Refseq | NP_940884 |
| UniProt ID | B3KSC4 |
| ◆ Recombinant Proteins | ||
| SH2D6-1338H | Recombinant Human SH2D6 Protein, MYC/DDK-tagged | +Inquiry |
| SH2D6-5355H | Recombinant Human SH2D6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH2D6 Products
Required fields are marked with *
My Review for All SH2D6 Products
Required fields are marked with *
