Recombinant Human SH2D6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SH2D6-5355H
Product Overview : SH2D6 MS Standard C13 and N15-labeled recombinant protein (NP_940884) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SH2D6 (SH2 Domain Containing 6) is a Protein Coding gene. Diseases associated with SH2D6 include Deafness, Autosomal Recessive 88. An important paralog of this gene is BLNK.
Molecular Mass : 19.1 kDa
AA Sequence : MYASSYPPPPQLSPRSHLCPPPPHPTPPQLNNLLLLEGRKSSLPSVAPTGSASAAEDSDLLTQPWYSGNCDRYAVESALLHLQKDGAYTVRPSSGPHGSQPFTLAVLLRGRVFNIPIRRLDGGRHYALGREGRNREELFSSVAAMVQHFMWHPLPLVDRHSGSRELTCLLFPTKPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SH2D6 SH2 domain containing 6 [ Homo sapiens (human) ]
Official Symbol SH2D6
Synonyms SH2D6; SH2 domain containing 6; SH2 domain-containing protein 6
Gene ID 284948
mRNA Refseq NM_198482
Protein Refseq NP_940884
UniProt ID B3KSC4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SH2D6 Products

Required fields are marked with *

My Review for All SH2D6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon