Recombinant Human SH3D19 protein, GST-tagged
| Cat.No. : | SH3D19-291H |
| Product Overview : | Recombinant Human SH3D19 protein(NP_001009555)(415-764 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 415-764 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | VLVMLKQTENNYLECQKGEDTGRVHLSQMKIITPLDEHLRSRPNDPSHAQKPVDSGAPHAVVLHDFPAEQVDDLNLTSGEIVYLLEKIDTDWYRGNCRNQIGIFPANYVKVIIDIPEGGNGKRECVSSHCVKGSRCVARFEYIGEQKDELSFSEGEIIILKEYVNEEWARGEVRGRTGIFPLNFVEPVEDYPTSGANVLSTKVPLKTKKEDSGSNSQVNSLPAEWCEALHSFTAETSDDLSFKRGDRIQILERLDSDWCRGRLQDREGIFPAVFVRPCPAEAKSMLAIVPKGRKAKALYDFRGENEDELSFKAGDIITELESVDDDWMSGELMGKSGIFPKNYIQFLQIS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
| Gene Name | SH3D19 SH3 domain containing 19 [ Homo sapiens ] |
| Official Symbol | SH3D19 |
| Synonyms | SH3D19; SH3 domain containing 19; SH3 domain-containing protein 19; DKFZp434D0215; EBP; EEN binding protein; EVE1; Kryn; SH3P19; EEN-binding protein; SH3 domain protein D19; ADAM-binding protein Eve-1; MGC105136; MGC118910; MGC118911; MGC118912; MGC118913; |
| Gene ID | 152503 |
| mRNA Refseq | NM_001009555 |
| Protein Refseq | NP_001009555 |
| MIM | 608674 |
| UniProt ID | Q5HYK7 |
| ◆ Recombinant Proteins | ||
| SH3D19-2913Z | Recombinant Zebrafish SH3D19 | +Inquiry |
| SH3D19-2459H | Recombinant Human SH3D19 protein, His-tagged | +Inquiry |
| SH3D19-291H | Recombinant Human SH3D19 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH3D19 Products
Required fields are marked with *
My Review for All SH3D19 Products
Required fields are marked with *
