Recombinant Human SH3GL1 protein, His-tagged

• Cat.No.: SH3GL1-2580H
• Product Overview: Recombinant Human SH3GL1 protein(233-313 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 233-313 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: LDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKA
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SH3GL1 SH3-domain GRB2-like 1 [ Homo sapiens ]
• Official Symbol: SH3GL1
• Synonyms: SH3GL1; SH3-domain GRB2-like 1; endophilin-A2; CNSA1; EEN; extra 11 19 leukemia fusion; fusion partner of MLL; MGC111371; SH3 domain GRB2 like 1; SH3 containing Grb 2 like 1 protein; SH3 containing protein EEN; SH3D2B; SH3P8; endophilin-2; SH3 domain protein 2B; EEN fusion partner of MLL; extra 11-19 leukemia fusion; SH3-containing Grb-2-like 1 protein; SH3 domain-containing GRB2-like protein 1; extra eleven-nineteen leukemia fusion gene protein
• Gene ID: 6455
• mRNA Refseq: NM_001199943
• Protein Refseq: NP_001186872
• MIM: 601768
• UniProt ID: Q99961