Recombinant Human SH3GL1 protein, His-tagged
Cat.No. : | SH3GL1-2580H |
Product Overview : | Recombinant Human SH3GL1 protein(233-313 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 233-313 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SH3GL1 SH3-domain GRB2-like 1 [ Homo sapiens ] |
Official Symbol | SH3GL1 |
Synonyms | SH3GL1; SH3-domain GRB2-like 1; endophilin-A2; CNSA1; EEN; extra 11 19 leukemia fusion; fusion partner of MLL; MGC111371; SH3 domain GRB2 like 1; SH3 containing Grb 2 like 1 protein; SH3 containing protein EEN; SH3D2B; SH3P8; endophilin-2; SH3 domain protein 2B; EEN fusion partner of MLL; extra 11-19 leukemia fusion; SH3-containing Grb-2-like 1 protein; SH3 domain-containing GRB2-like protein 1; extra eleven-nineteen leukemia fusion gene protein; |
Gene ID | 6455 |
mRNA Refseq | NM_001199943 |
Protein Refseq | NP_001186872 |
MIM | 601768 |
UniProt ID | Q99961 |
◆ Recombinant Proteins | ||
SH3GL1-2003H | Recombinant Human SH3GL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SH3GL1-30812TH | Recombinant Human SH3GL1, His-tagged | +Inquiry |
SH3GL1-301164H | Recombinant Human SH3GL1 protein, GST-tagged | +Inquiry |
SH3GL1-2104H | Recombinant Human SH3GL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SH3GL1-1185HFL | Recombinant Full Length Human SH3GL1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SH3GL1-1868HCL | Recombinant Human SH3GL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SH3GL1 Products
Required fields are marked with *
My Review for All SH3GL1 Products
Required fields are marked with *
0
Inquiry Basket