Recombinant Human SH3GL1 protein, His-tagged

Cat.No. : SH3GL1-2580H
Product Overview : Recombinant Human SH3GL1 protein(233-313 aa), fused to His tag, was expressed in E. coli.
Availability July 31, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 233-313 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : LDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKA
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name SH3GL1 SH3-domain GRB2-like 1 [ Homo sapiens ]
Official Symbol SH3GL1
Synonyms SH3GL1; SH3-domain GRB2-like 1; endophilin-A2; CNSA1; EEN; extra 11 19 leukemia fusion; fusion partner of MLL; MGC111371; SH3 domain GRB2 like 1; SH3 containing Grb 2 like 1 protein; SH3 containing protein EEN; SH3D2B; SH3P8; endophilin-2; SH3 domain protein 2B; EEN fusion partner of MLL; extra 11-19 leukemia fusion; SH3-containing Grb-2-like 1 protein; SH3 domain-containing GRB2-like protein 1; extra eleven-nineteen leukemia fusion gene protein;
Gene ID 6455
mRNA Refseq NM_001199943
Protein Refseq NP_001186872
MIM 601768
UniProt ID Q99961

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SH3GL1 Products

Required fields are marked with *

My Review for All SH3GL1 Products

Required fields are marked with *

0
cart-icon