Recombinant Human SH3GL1 protein, His-tagged
| Cat.No. : | SH3GL1-2580H |
| Product Overview : | Recombinant Human SH3GL1 protein(233-313 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 233-313 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | LDELAEKLKRRMREASSRPKREYKPKPREPFDLGEPEQSNGGFPCTTAPKIAASSSFRSSDKPIRTPSRSMPPLDQPSCKA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SH3GL1 SH3-domain GRB2-like 1 [ Homo sapiens ] |
| Official Symbol | SH3GL1 |
| Synonyms | SH3GL1; SH3-domain GRB2-like 1; endophilin-A2; CNSA1; EEN; extra 11 19 leukemia fusion; fusion partner of MLL; MGC111371; SH3 domain GRB2 like 1; SH3 containing Grb 2 like 1 protein; SH3 containing protein EEN; SH3D2B; SH3P8; endophilin-2; SH3 domain protein 2B; EEN fusion partner of MLL; extra 11-19 leukemia fusion; SH3-containing Grb-2-like 1 protein; SH3 domain-containing GRB2-like protein 1; extra eleven-nineteen leukemia fusion gene protein; |
| Gene ID | 6455 |
| mRNA Refseq | NM_001199943 |
| Protein Refseq | NP_001186872 |
| MIM | 601768 |
| UniProt ID | Q99961 |
| ◆ Recombinant Proteins | ||
| SH3GL1-2003H | Recombinant Human SH3GL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SH3GL1-6098C | Recombinant Chicken SH3GL1 | +Inquiry |
| SH3GL1-733HF | Recombinant Full Length Human SH3GL1 Protein, GST-tagged | +Inquiry |
| SH3GL1-2104H | Recombinant Human SH3GL1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| SH3GL1-5037R | Recombinant Rat SH3GL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SH3GL1-1868HCL | Recombinant Human SH3GL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SH3GL1 Products
Required fields are marked with *
My Review for All SH3GL1 Products
Required fields are marked with *
